External evidence

Research

Structured paper index and research notes connected to Levi's case.

Indexed papers
147
Structured metadata for the research corpus, last updated 2026-04-21.
Research notes
13

Freeform synthesis across diagnostics, treatments, mechanisms, and open questions.

Identification of mutations in the PI3K-AKT-mTOR signalling pathway in patients with macrocephaly and developmental delay and/or autism

Yeung KS, Tso WWY, Ip JJK, et al.

pi3k-akt-mtorovergrowthmacrocephalypediatric-epilepsydevelopmental-delay

Findings

Pathogenic/likely pathogenic variants in PTEN, PIK3CA, MTOR, and PPP2R5D found in ~10 children selected for macrocephaly + DD/ASD; all PI3K-AKT-mTOR-positive children had megalencephaly on MRI and lower DQ than the rest of the cohort. Two had somatic mosaic PIK3CA variants detectable in blood at low mosaicism.

Why it may matter for Levi

Directly supports ordering trio WES + CMA + methylation in Levi given symmetric overgrowth + DD + DEE-SWAS. The 9/9 megalencephaly-on-MRI rate among PI3K-AKT-mTOR-positive children in this cohort specifically argues for a neuroradiology re-read of Levi's MRI looking for subtle megalencephaly, cortical dysplasia, or bottom-of-sulcus dysplasia before de-emphasizing the pathway.

Epilepsy and Developmental Delay in Pediatric Patients With PTEN Variants and a Literature Review

Li, et al.

ptenphtspediatric-epilepsymacrocephaly

Findings

In a pediatric PTEN cohort (n=13), 100% had macrocephaly, 92% DD, 38% ASD, 15% epilepsy. Pooled data across seven studies (665 pediatric PTEN patients, 26 with epilepsy) show focal seizures are most common, and drug-resistant epilepsy is tightly associated with abnormal brain MRI.

Why it may matter for Levi

Supports PTEN testing in any child with macrocephaly + DD/ASD; places Levi's phenotype squarely in the PTEN-PHTS relevant population even without classic dysmorphism. Frames the MRI-abnormal subset as the drug-resistant epilepsy subset, reinforcing the case for a focused neuroradiology re-read.

Hyperactivity of mTORC1- and mTORC2-dependent signaling mediates epilepsy downstream of somatic PTEN loss

Lasser M, et al.

ptenpi3k-akt-mtormtor-inhibitionprecision-medicine

Findings

PTEN loss hyperactivates both mTORC1 and mTORC2; rapamycin rescues epilepsy and early mortality in mouse models even after epilepsy is established; for PTEN/PIK3CA/AKT disorders, dual PI3K/mTOR or AKT inhibitors may outperform mTORC1-selective rapalogs.

Why it may matter for Levi

Directly frames the mTOR-directed therapy treatment item. If a PTEN/PI3K/AKT variant is identified in Levi, the literature supports considering dual-pathway inhibitors rather than empiric rapalogs; empiric mTOR-directed therapy without molecular confirmation is not supported.

Mouse models of human PIK3CA-related brain overgrowth have acutely treatable epilepsy

Roy A, et al.

pik3camouse-modelpediatric-epilepsyakt-inhibition

Findings

PIK3CA signaling is directly epileptogenic independent of dysplasia; acute AKT inhibition suppresses seizures in mouse models; establishes PI3K-AKT signaling as a druggable target in malformation-associated pediatric epilepsy.

Why it may matter for Levi

Supports the mechanistic basis for precision therapy in PI3K-AKT-mTOR-axis disorders and provides rationale for specific drug selection once a molecular diagnosis is made. Reinforces that a PIK3CA-positive result would open an actionable therapeutic path, not a dead end.

PIK3CA-Related Overgrowth Spectrum (PROS) — GeneReviews

Keppler-Noreuil KM, et al.

pik3caprosgenereviewstargeted-therapy

Findings

Clinical practice guidelines (Douzgou 2022) for PROS; FDA-approved targeted therapy (alpelisib / Vijoice) exists; seizure types vary with mosaic tissue distribution; specific surveillance recommendations for tissue-distribution-dependent manifestations.

Why it may matter for Levi

Sets the management framework if a PIK3CA variant is found in Levi; informs what downstream subspecialty care and surveillance look like. Provides basis for the skin/retinal exam diagnostic item (surveillance) and for the conditional mTOR/targeted-therapy treatment item.

Brain overgrowth in disorders of RTK-PI3K-AKT signaling — A mosaic of malformations

Mirzaa GM, Poduri A

pi3k-akt-mtorsomatic-mosaicismbrain-overgrowth

Findings

Germline mutations trend toward whole-brain overgrowth; postzygotic somatic mutations trend toward hemimegalencephaly or focal cortical dysplasia. Describes the somatic-mosaicism gradient along the RTK-PI3K-AKT axis.

Why it may matter for Levi

Supports considering a germline mechanism in a symmetric-overgrowth phenotype like Levi's, and simultaneously argues for not dismissing low-mosaicism somatic variants if blood-only WES is negative. Motivates the potential need for affected-tissue testing downstream if blood WES is non-diagnostic.

PI3K/AKT pathway mutations cause a spectrum of brain malformations from megalencephaly to focal cortical dysplasia

Jansen LA, et al.

pi3k-akt-mtorfcdmegalencephalysomatic-mosaicism

Findings

PI3K/AKT pathway mutations cause a spectrum from megalencephaly to FCD, with somatic mosaicism explaining the focal-vs-hemispheric-vs-whole-brain gradient. Tissue-level sequencing required for low-mosaicism detection.

Why it may matter for Levi

Direct imaging/mechanistic reference for MRI neuroradiology re-read through an mTORopathy lens. If Levi's MRI shows even subtle FCD features, this paper anchors the PI3K/AKT pathway work-up as the next logical step.

Epilepsy in the mTORopathies — Opportunities for precision medicine

Moloney PB, et al.

mtoropathyprecision-medicineepilepsyeverolimus

Findings

Review of ≥16 distinct mTOR pathway genes producing epilepsy-plus-neurodevelopmental phenotypes; mTOR inhibitors (everolimus) already have labeled epilepsy indications in TSC; precision-medicine framework for the broader mTORopathy family.

Why it may matter for Levi

Framework reference for the conditional mTOR-pathway-directed therapy treatment item and for positioning Levi's overgrowth + epilepsy phenotype within the mTORopathy spectrum prior to molecular confirmation.

Analysis of common PI3K-AKT-MTOR mutations in pediatric surgical epilepsy by droplet digital PCR

D'Gama AM, et al.

pi3k-akt-mtorsomatic-mosaicismddpcrfcd

Findings

ddPCR on brain tissue required to detect low-mosaicism somatic variants; peripheral blood often misses them. ~80% of mutated FCD type II cases have brain mosaic rates <5% — below the sensitivity of standard sequencing.

Why it may matter for Levi

Sets expectations if blood-only WES is negative and a high-yield overgrowth/FCD phenotype remains on the table: affected-tissue (resected brain) sampling may be required. Informs how confident a negative blood WES should make us about the PI3K-AKT-mTOR hypothesis.

Seizures in Sotos syndrome — Phenotyping in 49 patients

Fortin O, et al.

sotosnsd1overgrowthpediatric-epilepsy

Findings

Largest Sotos seizure phenotyping cohort (49 patients, 15/20 with NSD1 pathogenic variants). Staring spells (67%) most common; febrile seizures and bilateral tonic-clonic each 51%; multiple seizure types in 67%; 18% drug-resistant; onset 3 months to 12 years.

Why it may matter for Levi

Frames what Sotos-related seizures look like and argues for formal NSD1 testing as part of the overgrowth-syndrome workup. Levi's DEE-SWAS semiology is not a typical Sotos presentation, but epilepsy is frequent enough to keep Sotos in the differential.

Sotos Syndrome — GeneReviews

Tatton-Brown K, Cole TRP, Rahman N

sotosnsd1genereviews

Findings

Classic reference. NSD1 variants in 60-90% of Sotos patients. ~25% non-febrile seizures. Classically described as a nonprogressive neurologic disorder with distinctive overgrowth + DD + facial gestalt.

Why it may matter for Levi

Establishes the diagnostic framework for Sotos and flags that classical Sotos is nonprogressive — Levi's frank regression is therefore atypical for isolated Sotos but does not rule it out, especially if DEE-SWAS is layered on top.

Weaver syndrome and EZH2 mutations — Clarifying the clinical phenotype

Tatton-Brown K, et al.

weaverezh2overgrowth

Findings

EZH2-related Weaver syndrome: >90% tall stature, ~80% ID (typically mild), epilepsy reported in a subset but less consistently than in Sotos. Significant phenotypic overlap with Sotos.

Why it may matter for Levi

Supports EZH2 testing as part of an epigenetic overgrowth panel. Classic camptodactyly and skin-texture findings not documented in Levi, but the phenotypic spectrum is wider than classic descriptions.

EZH2-Related Overgrowth — GeneReviews

Tatton-Brown K, et al.

ezh2weavergenereviews

Findings

Spectrum from classic Weaver syndrome to isolated tall stature. Management is supportive; no disease-modifying therapy.

Why it may matter for Levi

Supporting reference for the EZH2 workup pathway. Confirms that testing is clinically available and that positive results redirect surveillance but not acute management.

Increased expression of proinflammatory cytokines in the cerebrospinal fluid of patients with a history of electrical status epilepticus in sleep

(2025 authors)

dee-swasesescswscsf-cytokinesneuroinflammation

Findings

Children with ESES show elevated CSF IL-1β, TNF-α, IL-1α, and caspase-1 compared with non-ESES controls. IL-1β correlates with caspase-1 and TNF-α. Supports inflammasome involvement and biological rationale for anti-inflammatory therapy.

Why it may matter for Levi

Single strongest justification for obtaining repeat CSF cytokines in Levi. The April 7, 2026 LP did not send cytokines, which is the biggest avoidable diagnostic gap in his current workup.

Etiology is the key determinant of neuroinflammation in epilepsy — Elevation of CSF cytokines/chemokines in FIRES and febrile status epilepticus

Kothur K, et al.

firescsf-cytokinespediatric-epilepsyneuroinflammation

Findings

Th1-associated cytokines/chemokines (TNF-α, CXCL9, CXCL10, CXCL11), IL-6, CCL2, CCL19 elevated in CSF in FIRES/FRD; milder in febrile status; minimal elevation in chronic epilepsy. CSF cytokine profile is etiology-dependent, not a generic seizure response.

Why it may matter for Levi

Makes the case that CSF cytokine profiling can meaningfully discriminate inflammatory from non-inflammatory seizure encephalopathies in pediatric patients. Directly supports adding CSF cytokines to any repeat LP.

CSF and serum cytokine profiles in severe viral encephalitis with implications for refractory status epilepticus

(2024 authors)

csf-cytokinesviral-encephalitisrefractory-status-epilepticus

Findings

Cytokine profiles help distinguish primary viral encephalitis from immune-mediated parainfectious syndromes in pediatric patients with refractory status.

Why it may matter for Levi

Supporting evidence that CSF cytokine profiling is discriminating in pediatric seizure encephalopathies; reinforces the CSF-cytokines-on-repeat-LP recommendation.

Corticosteroids versus clobazam for treatment of children with epileptic encephalopathy with spike-wave activation in sleep (RESCUE ESES) — multicentre randomised controlled trial

van den Munckhof B, et al.

dee-swasesescswssteroidsclobazamrct

Findings

Underpowered RCT due to enrollment; ~25% IQ improvement in the steroid arm that was not seen in the clobazam arm. Side-effect burden similar. Authors caution that robust randomized evidence remains limited.

Why it may matter for Levi

Best available randomized evidence supporting steroid use in DEE-SWAS; informs Levi's steroid-taper strategy and the choice between monotherapy and combined steroid+benzodiazepine approaches.

Corticosteroids as treatment of epileptic syndromes with continuous spike-waves during slow-wave sleep

Buzatu M, et al.

cswssteroidstaper-strategypediatric-epilepsy

Findings

Retrospective 44-child cohort. Hydrocortisone 5 mg/kg/day, ~21-month slow taper. Long-lasting response in ~45%. Higher baseline IQ/DQ and shorter CSWS duration before treatment significantly associated with positive steroid response.

Why it may matter for Levi

Direct support for a long oral taper strategy in Levi rather than short pulse alone. The IQ-and-duration predictor has mixed implications for Levi (deep regression but dramatic acute response); the long-taper protocol is the single most concrete taper-strategy reference.

Current Status of Treatments for Children with Electrical Status in Slow-Wave Sleep (ESES/CSWS)

Kotagal P

cswsesesdee-swastreatment-hierarchyavoid-oxcarbazepine

Findings

Pooled analysis of 575 ESES cases. Efficacy rates — surgery ~90%, steroids ~81%, benzodiazepines ~68%, sulthiame ~53%, levetiracetam ~54%, standard ASMs ~49%. Oxcarbazepine and carbamazepine can worsen spike-wave index and should be avoided.

Why it may matter for Levi

Direct ranking evidence for Levi's treatment hierarchy; establishes avoid-oxcarbazepine/carbamazepine as a specific actionable caution. Supports the sulthiame + high-dose benzodiazepine fallback tier.

European steroid practice survey in DEE-SWAS / CSWS

(2025 authors)

dee-swascswssteroidspractice-variation

Findings

Practice-variation survey across major European DEE-SWAS centers; many regimens in use; no standardized protocol; all centers use steroids as a first-line option.

Why it may matter for Levi

Confirms there is no single canonical steroid protocol and that taper duration, dose, and route all vary meaningfully across centers — useful context for framing Levi's taper decisions as reasonable-range choices rather than protocol deviations.

Current and Future Treatment Strategies in DEE-SWAS — A Time for Precision Medicine?

(2025 authors)

dee-swascswsprecision-medicinetreatment-review

Findings

Review arguing for a paradigm shift toward etiology-driven precision-medicine rather than syndrome-driven treatment; reports <33% of patients without cognitive sequelae under the classic syndrome-driven approach.

Why it may matter for Levi

Anchors the general argument that Levi's best long-term outcome depends on identifying and treating the underlying cause, not just suppressing spike-wave activity. Frames the genetic + CSF-inflammatory workup as part of the therapeutic plan, not separate from it.

IVIG in pediatric ESES — Saudi multicenter observational study

(2023 authors)

ivigesesdee-swassteroid-sparing

Findings

IVIG alone significantly improved 6-month cognitive scores vs steroid alone; no additional effect when combined. Suggests IVIG and steroids have distinct mechanisms.

Why it may matter for Levi

Supports IVIG as a steroid-sparing option if relapse occurs off steroids, particularly if a cell-mediated or humoral inflammatory driver is suspected. Frames the contingent-immunomodulation treatment item.

Treatment of Developmental/Epileptic Encephalopathy With Spike-Wave Activation in Sleep

(Practical Neurology editorial team)

dee-swascswstreatment-reviewavoid-oxcarbazepine

Findings

Clinician-facing treatment review; emphasizes avoidance of oxcarbazepine and carbamazepine (can worsen spike-wave index) and summarizes practical steroid, benzodiazepine, and sulthiame approaches.

Why it may matter for Levi

Concise clinician-facing summary useful for family/clinician conversations and for the explicit avoid-oxcarbazepine/carbamazepine clinical guidance in Levi's care plan.

Clinical approach to the diagnosis of autoimmune encephalitis in the pediatric patient

Cellucci T, van Mater H, Graus F, et al.

seronegative-aepediatric-autoimmune-encephalitiscellucci-criteria

Findings

Pediatric-specific AE criteria. Three categories — possible AE, probable antibody-negative AE, definite antibody-positive AE. Incorporates EEG and developmental criteria.

Why it may matter for Levi

Correct framework for evaluating the seronegative-AE hypothesis in Levi. His workup is incomplete under Cellucci criteria because CSF cytokines/AE panel/neopterin were not sent and infectious PCR on CSF is not documented.

A clinical approach to diagnosis of autoimmune encephalitis

Graus F, Titulaer MJ, Balu R, et al.

autoimmune-encephalitisgraus-criteria

Findings

Original adult criteria framework for AE, including probable antibody-negative AE. Subsequent pitfalls review notes high mimic rate and need to exclude alternative etiologies.

Why it may matter for Levi

Background reference for the AE diagnostic framework; the Cellucci pediatric criteria are the primary tool but Graus is the parent framework.

Differential diagnosis and comparison of diagnostic algorithms in children and adolescents with autoimmune encephalitis in Spain

Armangué T, et al.

seronegative-aemimicspediatric-aediagnostic-algorithm

Findings

Prospective cohort comparing Graus and Cellucci algorithms. Mimics common; false-positive serum antibodies common. Specificity of Graus 'possible AE' before infectious testing as low as 8%. Specificity for 'probable seronegative AE' rose to 99% when mimics excluded.

Why it may matter for Levi

Key evidence that a clean seronegative-AE diagnosis in Levi requires ruling out mimics (metabolic, genetic, structural, post-infectious) rather than inferring AE from ambiguous serum cytokines alone.

Seronegative autoimmune encephalitis in children — what's in a name?

Titulaer MJ

seronegative-aepediatric-aediagnostic-rigor

Findings

Editorial/review emphasizing that the AE label is often applied loosely in pediatrics and that alternative diagnoses are common. Argues for rigorous application of pediatric AE criteria and mimic exclusion.

Why it may matter for Levi

Directly cautions against calling a case seronegative AE without formal criteria fulfillment — relevant to Levi because the serum Th1/Th17 cytokine pattern alone does not satisfy Cellucci criteria for probable antibody-negative AE.

Mimics of Autoimmune Encephalitis

(2023 authors)

autoimmune-encephalitismimicsmri

Findings

Extralimbic MRI involvement, enhancement, diffusion restriction are more common in mimics than in AE. Helps differentiate true AE from genetic, metabolic, and structural mimics.

Why it may matter for Levi

Supports a careful read of Levi's MRI pattern (mild nonspecific periventricular FLAIR) in the context of the AE-mimic literature; the current imaging is not classically AE-like.

Th17 cells and inflammation in neurological disorders — Possible mechanisms of action

(2022 authors)

th17neuroinflammationil-17mechanistic-review

Findings

Review: Th17 cells produce IL-17A, IL-21, IL-23, IL-6, and IFN-γ, with known roles in MS, NMO, and other CNS autoimmune syndromes; IFN-γ and Th1/Th17 cell ratios discriminate MS phenotypes.

Why it may matter for Levi

Mechanistic backing for why a peripheral Th1/Th17-weighted serum cytokine pattern could map to CNS inflammation, while acknowledging that the serum pattern alone is not diagnostic.

The critical role of Th17 cells and IL-17A in autoimmune and inflammation-associated neurological diseases

(2025 authors)

th17il-17neuroinflammation2025-review

Findings

2025 update on Th17/IL-17A biology in CNS autoimmunity and inflammation-associated neurological disease; summarizes therapeutic targeting opportunities.

Why it may matter for Levi

Supporting reference for framing Th17 pathway biology if follow-on evidence (CSF cytokines off steroids) confirms persistent Th17 skew in Levi.

Glucocorticoids promote intrinsic human TH17 differentiation

(2018 authors)

glucocorticoidsth17cytokine-interpretationsteroid-confounder

Findings

Glucocorticoids can paradoxically promote Th17 differentiation by suppressing IL-2. Demonstrated in human cells; mechanistic basis for apparent post-steroid Th17 skew.

Why it may matter for Levi

Critical caveat for interpreting Levi's April 6, 2026 serum Th17 elevation, which was drawn after the methylprednisolone pulse. The Th17 signature may partly reflect post-steroid physiology rather than the underlying inflammatory state. Drives the repeat-serum-cytokine-off-steroids diagnostic item.

Low Relative Abundances of the Mucolytic Bacterium Akkermansia muciniphila and Bifidobacterium spp. in Feces of Children with Autism

Wang L, et al.

akkermansiaasd-microbiomegut-brain

Findings

Foundational ASD-microbiome paper. qPCR showed lower relative abundance of Akkermansia muciniphila and Bifidobacterium in children with autism vs controls. Authors cautioned about interpretation because mucolytic alternatives exist.

Why it may matter for Levi

The direction of the ASD-Akkermansia association is lower abundance, not higher. Levi's lab result of Akkermansia overabundance is therefore not consistent with the main ASD microbiome literature and does not support elevating the gut-microbiome-driver hypothesis.

Akkermansia muciniphila and the Gut Immune System — A Good Friendship That Attenuates Inflammatory Bowel Disease, Obesity, and Diabetes

(review authors)

akkermansiagut-immunegut-barrier

Findings

Review of Akkermansia immunomodulatory and barrier roles; generally beneficial in health states; context-dependent in specific disease states.

Why it may matter for Levi

Background support for the claim that moderate Akkermansia abundance is typically beneficial; overabundance is not a well-validated pediatric disease signal in isolation.

Rediscovering parainfectious encephalopathy in the post-COVID-19 era

(2025 Frontiers authors)

parainfectious-encephalopathypost-infectiouspediatric-neuroinflammation

Findings

Review of the parainfectious encephalopathy spectrum. MERS, ANE, FIRES all driven by innate immune overreaction rather than direct viral invasion. Severity spans reversible to catastrophic.

Why it may matter for Levi

Supports a two-hit framing for the January 2026 leukocytosis event as a possible precipitant of DEE-SWAS in an already-vulnerable child, even though Levi does not have a classic parainfectious encephalopathy presentation.

Management of pediatric post-infectious neurological syndromes

(2021 authors)

post-infectiousadempediatric-neurology

Findings

ADEM is the most common pediatric post-infectious encephalopathy; latent period 1-2 weeks; multifocal self-limiting symptoms in most; recommendations for workup and management.

Why it may matter for Levi

Supports the retrospective-chart-review diagnostic item for the January 2026 event and informs the post-infectious-trigger differential theory's evidence base.

Iron Deficiency Affects Seizure Susceptibility in a Time- and Sex-Specific Manner

(2017 authors)

iron-deficiencyseizure-thresholdanimal-model

Findings

Animal-model evidence that dietary iron deficiency lowers seizure threshold depending on developmental window and sex.

Why it may matter for Levi

Mechanistic support for iron repletion as a seizure-amplifier correction in Levi regardless of root cause. Bolsters the iron-deficiency-amplifier differential theory.

Associative Patterns Between Iron Deficiency Anemia and Febrile Seizures in the Five to 60 Months Age Group — A Comprehensive Systematic Review

(systematic review authors)

iron-deficiencypediatric-seizuressystematic-review

Findings

Systematic review showing an association between iron deficiency anemia and febrile seizures in young children; magnitude and replication vary.

Why it may matter for Levi

Human-side evidence supporting iron repletion as a standard-of-care modifier in a child with seizure activity and confirmed iron deficiency.

The Tatton-Brown-Rahman Syndrome: A clinical study of 55 individuals with de novo constitutive DNMT3A variants

Tatton-Brown K, Zachariou A, Loveday C, et al.

dnmt3atbrsovergrowthintellectual-disabilityautismepilepsychromatinopathy

Findings

Largest TBRS cohort (n=55). 100% intellectual disability, 83% overgrowth (height and/or HC ≥+2 SD), mean birth HC +2.3 SD, 74% joint hypermobility, 67% obesity, 54% hypotonia, 51% behavioral/psychiatric issues, 36% autism, 22% afebrile seizures, 7% regression (mostly adolescent), 33% kyphoscoliosis, one AML. DEE-SWAS/ESES not specifically characterized.

Why it may matter for Levi

Anchors DNMT3A/TBRS as a germline chromatinopathy whose phenotype overlaps Levi's on overgrowth, ASD, and seizure axes. Germline coding variants already excluded by Stanford exome, GeneDx WGS, and reanalysis — so TBRS is now a residual epigenetic/mosaic/functional-readout hypothesis, not a missed coding-variant hypothesis.

Tatton-Brown-Rahman Syndrome — GeneReviews

Tatton-Brown K, Rahman N

dnmt3atbrsgenereviewssurveillanceepisignature

Findings

Authoritative reference on TBRS. Cardinal features: tall stature, macrocephaly, intellectual disability, subtle facial gestalt. Afebrile seizures ~20%. Cardiac findings (aortic root dilation most common). AML risk elevated ~2x. Diagnosis via DNMT3A sequencing or DNA methylation episignature (EpiSign). No TBRS-specific antiseizure guidance.

Why it may matter for Levi

Clinical-management reference for TBRS. Confirms a robust EpiSign episignature is available as a functional test even when sequencing is uninformative. Surveillance implications for Levi (AML screening, aortic imaging) if TBRS is ever confirmed.

Epileptic encephalopathy with spike-and-wave activation in sleep associated with Tatton-Brown-Rahman syndrome responsive to highly purified cannabidiol

Datta AN, et al.

dnmt3atbrsdee-swasesescannabidiolpediatric-epilepsy

Findings

Case report (2026) of a pediatric TBRS patient (confirmed DNMT3A variant) who developed EE-SWAS (the ILAE 2022 umbrella that includes DEE-SWAS), was refractory to conventional antiseizure medications, and responded to highly purified cannabidiol. Full text was paywalled at ingest; abstract-level summary pending full-text review.

Why it may matter for Levi

The single most directly phenotype-matched publication: DNMT3A / TBRS can produce exactly Levi's EEG syndrome. Does not by itself reverse the negative germline workups, but (a) establishes TBRS as a known cause of Levi's specific epilepsy syndrome, (b) materially strengthens the case for methylation / episignature testing, and (c) opens cannabidiol as a specific second-line option if TBRS is ever confirmed and Levi relapses off steroids.

Tatton-Brown-Rahman syndrome: Novel pathogenic variants and new neuroimaging findings

Jiménez de la Peña M, et al.

dnmt3atbrsneuroimagingcorpus-callosumcortical-thickness

Findings

Four TBRS patients with structured MRI + DTI. Recurrent findings: corpus callosum anomalies, small posterior fossa, deep left Sylvian fissure, asymmetric uncinate / arcuate fascicles on tractography, increased cortical thickness. Periventricular FLAIR white-matter signal is not a recognized TBRS feature.

Why it may matter for Levi

Levi's MRI pattern (nonspecific R>L periventricular FLAIR, otherwise unremarkable) does not match the published TBRS imaging gestalt — modestly negative for TBRS. But TBRS-typical features require morphometric / DTI reads to detect and may have been missed on general pediatric MRI read; argues for expanding the scope of the specialized neuroradiology re-read to include TBRS screening (corpus callosum, posterior fossa, cortical thickness, tract asymmetry) alongside mosaic mTORopathy screening.

Evaluation of DNA Methylation Episignatures for Diagnosis and Phenotype Correlations in 42 Mendelian Neurodevelopmental Disorders

Levy MA, Relator R, McConkey H, et al.

episignatureepisignmethylationchromatinopathydnmt3asotoskabuki

Findings

Systematic derivation and validation of peripheral-blood methylation episignatures across 42 Mendelian NDDs including DNMT3A (TBRS), NSD1 (Sotos), EZH2 (Weaver), KMT2D (Kabuki 1), KDM6A, ATRX, CHD7/CHARGE, CHD8, and others. DNMT3A loss-of-function variants produce a robust characteristic hypomethylation episignature. Episignatures can diagnose patients with clinically suggestive phenotypes even when standard sequencing is negative.

Why it may matter for Levi

Technical foundation for EpiSign / methylation panel as a functional diagnostic in Levi's case. Tests a different mechanism (genome-wide methylation state) than the three already-negative sequencing workups. A single panel covers DNMT3A, NSD1, EZH2, KMT2D, ATRX, and imprinting loci at once.

Episignatures in practice: independent evaluation of published episignatures for the molecular diagnostics of ten neurodevelopmental disorders

van der Sanden BPGH, et al.

episignaturemethylationdnmt3ansd1diagnostic-sensitivity

Findings

Independent validation of published episignatures. Specificity 100% across all signatures. DNMT3A, ATRX, KMT2D, and NSD1 episignatures reach 100% sensitivity. CREBBP-RSTS and one CHD8 signature reach <40% sensitivity — an important caveat for interpreting negative results.

Why it may matter for Levi

The single strongest external argument for prioritizing an episignature panel in Levi's workup: DNMT3A/TBRS and NSD1/Sotos episignatures both have essentially perfect clinical sensitivity in independent hands. A negative blood episignature at DNMT3A would be a strong functional argument against TBRS that the existing WGS cannot provide.

Chromatinopathies: insight in clinical aspects and underlying epigenetic changes (review)

Ciolfi A, et al.

chromatinopathyepisignaturemethylationreviewovergrowth

Findings

Review of ~154 epigenes now linked to Mendelian chromatinopathies, many with distinctive blood methylation episignatures. Signatures may overlap across functional complexes (KDM6A/KMT2D, PRC2, ASXL1/2). Episignature testing improves diagnostic yield in suggestive phenotypes with negative sequencing and can detect low-level postzygotic mosaicism in some epigenes.

Why it may matter for Levi

Frames the broader chromatinopathy axis into which DNMT3A, NSD1, EZH2, KMT2D, ATRX, and several other overgrowth / ID syndromes on Levi's differential all fall. Supports ordering a single episignature panel rather than gene-by-gene follow-up.

Beckwith-Wiedemann Syndrome — GeneReviews

Shuman C, Beckwith JB, Weksberg R

bwsbeckwith-wiedemann11p15imprintingmethylationgenereviews

Findings

Authoritative BWS reference. Molecular subtypes: IC2 LOM (50-60%), paternal UPD 11p15 (20-25%, often mosaic), IC1 GOM (5-10%), CDKN1C variants. Classical features: overgrowth, macroglossia, macrosomia, omphalocele, neonatal hypoglycemia, hemihyperplasia, embryonal tumor risk (Wilms, hepatoblastoma). Development typically unaffected in classical BWS; neurodevelopmental risk is concentrated in 11p15 microdeletions encompassing ICR2 and extended CNVs. Tissue mosaicism is common; a single negative blood test does not exclude BWS.

Why it may matter for Levi

Classical BWS is a poor phenotype match for Levi (no macroglossia, no omphalocele, no neonatal hypoglycemia, no hemihyperplasia, proportional rather than asymmetric overgrowth). Still worth including on MS-MLPA at zero marginal cost; closes the 11p15 imprinting branch cleanly whether positive or negative.

Solving the etiology of Developmental and Epileptic Encephalopathy with Spike-Wave activation in Sleep (D/EE-SWAS)

Viswanathan S, Oliver KL, Regan BM, et al., Mefford HC, Scheffer IE

dee-swasee-swasepilepsy-aphasia-spectrumgrin2acnksr2channelopathytranscriptional-regulatorschromatinopathynprl2mtor-pathwaysomatic-mosaicismpolymicrogyriathalamic-lesionilae-2022ingrid-schefferheather-mefford

Findings

Largest published etiology cohort for ILAE-2022 DEE-SWAS / EE-SWAS (n=101; Melbourne Epilepsy Genetics + collaborators). 46% etiologically solved overall; 66% in DEE-SWAS, 28% in EE-SWAS. 20 single genes implicated in 32 patients; 10 novel (ATP1A2, CACNA1A, FOXP1, GRIN1, KCNMA1, KCNQ3, PPFIA3, PUF60, SETD1B, ZBTB18) and 10 previously described (GRIN2A most common at 23% of solved, plus ARID1B, CNKSR2, CUL4B, GRIN2B, KCNH5, MECP2, NPRL2, SCN1A, SCN2A). 6 CNVs in 7 patients, including two novel (17p11.2 duplication not involving RAI1; 5q22 deletion). 18/20 genes cluster into two significantly co-expressed brain networks: ion channels/scaffolding/adhesion vs. transcriptional regulators/chromatin modifiers. Only NPRL2 is in the mTOR axis; ATP1A2 is the other outlier. 82% of the cohort had a normal MRI; structural cases clustered on the thalamocortical network (perisylvian polymicrogyria, unilateral thalamic lesions, post-hemorrhagic hydrocephalus). 3/101 evolved to Lennox-Gastaut syndrome years after SWAS detection.

Why it may matter for Levi

Most directly phenotype-matched etiological paper for Levi's specific diagnosis. Sets expectation that ~55% of DEE-SWAS cases have an identified germline genetic cause; Levi is in the harder-to-solve minority after three negative germline workups, which justifies extending the search beyond standard trio sequencing. Mild negative signal for the mTOR-axis theories (only 1/20 genes, NPRL2, is in that pathway and that patient had polymicrogyria). Strengthens the chromatinopathy / transcriptional-regulator branch (7/20 genes are transcriptional regulators, including SETD1B which is on the EpiSign panel, reinforcing rank-2 diagnostic priority on methylation / episignature testing). GRIN2A is the single highest-yield gene (23% of solved cases) and deserves explicit coverage confirmation against Stanford / GeneDx report text. Cites Krey 2022 on L-serine as a GRIN-null targeted therapy — contingent lever if a GRIN gene is ever identified in Levi. Longitudinal LGS-evolution risk sharpens prognostic counseling. Structural etiologies are thalamocortical — Levi's MRI shows none of these patterns, consistent with down-weighting the structural-vascular theory. Senior authors Ingrid Scheffer (Melbourne) and Heather Mefford (St Jude) are the two highest-authority DEE-SWAS etiology researchers globally and are reasonable outreach targets.

RHEB/mTOR hyperactivity causes cortical malformations and epileptic seizures through increased axonal connectivity

Proietti Onori M, Koene LMC, Schäfer CB, Nellist M, de Brito van Velze M, Gao Z, Elgersma Y, van Woerden GM

rhebmtormtorc1mtoropathypi3k-akt-mtorcortical-malformationheterotopiafocal-cortical-dysplasiasomatic-mosaicismin-utero-electroporationmouse-modelaxonal-connectivityepilepsyrapamycinmechanismvan-woerdenelgersmaerasmus-encore

Findings

Mechanistic mouse study of the human RHEB p.P37L variant (Reijnders et al. 2017 — ID, megalencephaly, epilepsy). RHEB p.P37L is a GAP-resistant gain-of-function variant that drives constitutive mTORC1 hyperactivity. In utero electroporation of RHEB-P37L into mouse L2/3 somatosensory cortex recapitulates human mTORopathy pathology — neuronal hypertrophy, heterotopic nodules, disrupted lamination — and produces reliable spontaneous tonic-clonic seizures, fully rescued by rapamycin at both the biochemical and seizure level. Two pivotal circuit results: (1) the heterotopic nodule is neither necessary nor sufficient for seizures — a subset of animals seize without a detectable malformation; (2) seizures require ongoing mTOR hyperactivity (Cre-ERT2 switch-off after malformation is frozen prevents seizures) and are driven by enhanced long-range axonal connectivity of RHEB-P37L neurons onto normal-appearing contralateral cortex. Selective tetanus-toxin silencing of RHEB-P37L vesicle release — including only at callosal terminals — abolishes seizures. Reframes mTORopathy epilepsy as a distributed-connectivity disorder rather than a focal-malformation disorder.

Why it may matter for Levi

Directly supports keeping mosaic PI3K-AKT-mTOR as Theory 1 in Levi's Root Cause Theories despite his structurally unremarkable April 2026 MRI. The paper demonstrates that an mTOR-pathway gain-of-function can drive reliable spontaneous seizures without a detectable cortical malformation via aberrant long-range axonal connectivity onto normal-appearing cortex — a mechanism compatible with Levi's bilateral multifocal sleep-activated DEE-SWAS pattern. RHEB itself is an explicit phenotype match (ID + megalencephaly + epilepsy; Reijnders 2017) and should be confirmed as covered in Levi's germline trio exome/WGS and included with deep coverage on any mosaic-sensitive tissue-based PROS / PI3K-AKT-mTOR panel from buccal swab or skin punch — the current top-ranked next diagnostic. Rapamycin's rescue of both biochemistry and spontaneous seizures is preclinical support for everolimus / sirolimus as a mechanism-directed treatment if any PI3K-AKT-mTOR variant (germline or mosaic) is identified. Cre-ERT2 rescue after the malformation is frozen suggests therapeutic benefit is possible even if a subtle structural substrate has already been established. The van Woerden / Elgersma group at ENCORE / Erasmus MC in Rotterdam is an active mTORopathy research program and a reasonable long-tail outreach target complementary to Mirzaa / Poduri / Aldinger.

Psychiatric Adverse Effects of Pediatric Corticosteroid Use

Stuart FA, Segal TY, Keady S

corticosteroidpsychiatric-adverse-effectspediatricmethylprednisolonewithdrawalirritabilityaggressionapse

Findings

Mayo Clinic Proceedings systematic review of adverse psychological effects (APSE) of corticosteroids in children. APSE includes mood swings, irritability, depression, anxiety, behavioral dyscontrol, aggression, attention problems, and at the severe end mania/psychosis. APSE can occur at any point during treatment including withdrawal. In adults most reactions occur in the first week or two; in pediatrics, case reports describe psychiatric reactions emerging 1–11 days after corticosteroid cessation, occasionally as combativeness and emotional lability. No prospective pediatric cohort estimates absolute incidence of post-cessation behavioral worsening at the 2–6 week mark. Severe presentations have been managed with benzodiazepines (lorazepam) and antipsychotics (risperidone).

Why it may matter for Levi

Strongest pediatric synthesis supporting that behavioral worsening after a corticosteroid course is real and includes irritability and aggression, not only frank psychosis. Justifies keeping post-pulse aftermath on Levi's differential for the current 3.5-week-post-pulse behavioral change without inferring it must mean SWI rebound. Documents that delayed-onset (after-cessation) presentations are part of the pediatric APSE spectrum, not an exotic mechanism.

Intravenous pulse methylprednisolone and corticosteroid-induced psychiatric disorders: A retrospective study

Nishimura K, et al.

methylprednisoloneintravenous-pulsepsychiatric-adverse-effectscipdincidencepost-pulse-rebound

Findings

Single-center retrospective study (Japanese university hospital) of 14,585 corticosteroid recipients; 85 diagnosed with corticosteroid-induced psychiatric disorder (CIPD) (overall incidence 0.6%). Among 523 IVMP recipients, CIPD incidence was 6.1% (32/523) — about 10× higher than non-pulse use. Within IVMP-related CIPDs, post-pulse onset (22.4%) was more common than during-pulse onset (14.1%). Earlier dose-response data show 18.6% CIPDs at prednisone ≥80 mg/day vs. 1.3% at ≤40 mg/day; 75% of CIPDs are mood symptoms. Adult/mixed cohort, not pediatric.

Why it may matter for Levi

Best available IVMP-specific incidence anchor: approximately 6% of IVMP recipients develop a clinically diagnosed psychiatric disorder, with the post-pulse window the more common emergence interval than the pulse itself. Subclinical irritability and frustration are presumably much more common than this 6% headline. Supports treating Levi's behavioral worsening 3.5 weeks after a 3-day IV methylprednisolone pulse as well within the documented natural history of IVMP rather than as evidence of relapse by itself. Pediatric data are unavailable but this is the closest IVMP-specific study.

Pulse steroid therapy in multiple sclerosis and mood changes: An exploratory prospective study

Lorefice L, et al.

methylprednisoloneintravenous-pulsemooddepressionmultiple-sclerosis1-month-follow-uppost-pulse-rebound

Findings

Exploratory prospective single-center study of 101 MS patients receiving 1000 mg IV methylprednisolone, with mood assessments (BDI-II, MDQ) at three timepoints: pre-pulse, post-pulse, and 1 month post-pulse. At baseline, 31.7% had depressive symptoms and 19.8% had bipolar-spectrum positivity. Mood changes detectable at the 1-month follow-up; MDQ-positive (bipolar-spectrum) patients particularly vulnerable. Authors recommend pre-treatment mood screening and caution in MDQ-positive patients.

Why it may matter for Levi

Most temporally specific external anchor for the 1-month-after-pulse window in which Jake and Miki are observing increased frustration and aggression in Levi. Adult MS cohort cannot be directly extrapolated to a 5.5-year-old non-verbal child, but the existence of detectable mood changes specifically at the 1-month mark — rather than only during/immediately after the pulse — is the closest published evidence that the 'a few weeks later' window is real.

Patient-reported adverse effects of high-dose intravenous methylprednisolone treatment: a prospective web-based multi-center study in multiple sclerosis patients with a relapse

Morrow SA, et al.

methylprednisoloneintravenous-pulseadverse-effectspatient-reportedsleep-disturbanceagitationbehavioral-changesmultiple-sclerosis

Findings

Prospective web-based multi-center study of 85 MS patients receiving high-dose IVMP, with self-report at baseline, day 2 of treatment, day 1 post-treatment, and 1 week post-treatment. Median 4 AEs per pulse. Most frequent: change in taste (61%), facial flushing (61%), feeling sick / stomach pain (53%), sleep disturbance (44%), appetite change (37%), agitation (36%), behavioral changes (36%). Sleep disturbance, agitation, anger/bad temper, depression, behavioral change classified as CNS-related and persisted at 1 week post-treatment.

Why it may matter for Levi

Establishes that CNS-related effects (sleep disturbance, agitation, behavioral change) are extremely common after IVMP — on the order of 30–45% in self-report — and persist at least 1 week post-pulse. Sleep disturbance is one of the most common AEs and is a strong independent driver of irritability and aggression in young children, so even if direct mood effects fade, residual sleep disruption could be propagating into Levi's current behavior. Maximum follow-up is 1 week, so the study cannot directly speak to the 3-week-later window; Lorefice 2018 fills that gap.

Neurobehavioral Side Effects of Corticosteroids During Active Treatment for Acute Lymphoblastic Leukemia in Children are Age-Dependent: Report from Dana-Farber Cancer Institute ALL Consortium Protocol 00-01

Mrakotsky CM, et al.

corticosteroidneurobehavioralpediatricpreschoolprednisonedexamethasoneall-leukemiaage-dependent

Findings

Prospective parent-rated study within DFCI ALL Consortium Protocol 00-01. 62 children aged 2–17 on cyclical 5-day prednisone (40 mg/m²/day) or dexamethasone (6 mg/m²/day). Behavior ratings at baseline (Day 0), active steroid (Day 7), post-steroid (Days 14, 21). Preschoolers (<6 y) had clinically significant increases in emotional control, mood, behavior regulation, and executive function problems during the steroid week (p<.001), returning to baseline during the two off-steroid weeks. School-age children (≥6 y) showed no comparable effect. Mechanism: high steroid-receptor density in hippocampal and frontal regions.

Why it may matter for Levi

Levi (5.5 y) sits in the dramatically more behaviorally susceptible preschool age bracket. Argues that for cyclical low-dose oral exposure, behavior returns to baseline within ~2 weeks — a partial counter-data point to the 'delayed rebound at 3.5 weeks' hypothesis. Important caveat: a single 3-day high-dose IV pulse (~20 mg/kg/day) is a very different point in the dose-time space than 40 mg/m² oral prednisone; absence of a 2–3-week-later effect in Mrakotsky does not exclude one in Levi's regimen, but it sets a useful prior.

Exploratory analysis of high-dose corticosteroid therapy on epileptic encephalopathy with spike-and-wave activation in sleep

Wuxi Children's Hospital cohort (2016–2022)

dee-swasee-swasesescswshigh-dose-corticosteroidmethylprednisolonerelapsefrontal-lobe-dischargespredictive-model

Findings

Single-center retrospective Chinese pediatric DEE-SWAS / EE-SWAS cohort (ages 3–17, 2016–2022) treated with high-dose IV methylprednisolone followed by sequential oral prednisone, ≥6 months follow-up. High response rate, particularly with older age at ESES onset and concomitant benzodiazepines. Predictive model for ESES recurrence built from age at seizure onset and concomitant frontal-lobe discharges, with good predictive efficiency. Frontal-lobe discharges marked a higher-risk subgroup for relapse after corticosteroid taper.

Why it may matter for Levi

Levi's UCSF EEG (2026-04-06) named F4 (right mid-frontal) as a focus for the first time across the three ingested EEGs. Under this paper's predictive model, the presence of frontal-lobe discharges is itself a relapse-risk feature independent of his SWI drop. Sharpens the 'spikes are coming back' hypothesis specifically because of the F4 focus, not just because Levi had DEE-SWAS at all. Supports a low threshold for moving the next quantitative SWI EEG forward if behavioral signal worsens with sleep changes or skill regression.

Scalp EEG high frequency oscillations as a biomarker of treatment response in epileptic encephalopathy with continuous spike-and-wave during sleep (CSWS)

Gong P, et al.

cswsesesdee-swashigh-frequency-oscillationshfosmethylprednisolonerelapse-biomarkereeg-biomarker

Findings

Prospective pediatric CSWS cohort (n=22) treated with methylprednisolone, stratified by 2-week response and then by 3-month outcome. In the response-with-relapse subgroup (n=11), HFO detection was dramatically higher than ESES detection at every timepoint: 81.2% vs 27.3% at 2 weeks, 90.9% vs 36.4% at 3 months, 100% vs 54.5% at 6 months. Average IQ improved significantly only in the non-relapse subgroup. HFO persistence correlated negatively with IQ; ESES persistence did not. Authors propose HFOs as a non-invasive biomarker for predicting seizure and cognitive outcome.

Why it may matter for Levi

Reinforces that a clean-looking post-pulse EEG (Levi's UCSF 'occasional bursts') does not rule out ongoing subclinical epileptiform activity invisible to conventional SWI. If Levi's behavior is worsening due to true neurophysiological re-emergence, it could be HFO-level activity that the next conventional EEG would still miss. Provides a soft argument to ask the next EEG team about quantitative SWI and (where available) HFO analysis rather than relying solely on visual SWI estimation.

Assessment of Behavior Abnormalities of Corticosteroids in Children with Nephrotic Syndrome

Soliman NA, et al., (Zagazig University)

nephrotic-syndromepediatriccorticosteroidoral-prednisoneaggressionanxietydepressioncdibehavior-trajectoryweek-3-week-7

Findings

Prospective pediatric study of 30 children (ages 6-16, mean 9.9 y) with steroid-sensitive idiopathic nephrotic syndrome during a 7-week relapse course. Regimen was ORAL prednisone (2 mg/kg/day tapering to alternate-day ~1.4-1.7 mg/kg by weeks 5-7), not IV pulse. Standardized self-report instruments (CDI, Children Anxiety Scale, Aggression Questionnaire). Anxiety rose from mean 16.2 at baseline to peak 27.9 at week 3, remaining elevated at 22.7 at week 7 (p<0.001). Depression and aggression followed the same peak-at-week-3, still-elevated-at-week-7 pattern. Onset by week 1, peak around week 3, still elevated at week 7.

Why it may matter for Levi

Closest pediatric study to the specific timeframe Jake and Miki are observing (around 3 weeks in). Demonstrates that in pediatric corticosteroid exposure, behavior symptom scores peak around week 3 and remain elevated through at least week 7. Important caveat - the exposure modality (continuous oral, 7 weeks) is different from Levi's 3-day IV pulse. The parallel is mechanistic (HPA-axis and cytokine dynamics) rather than regimen-matched. Supports the framing that around 3 weeks in is not a strange or unexpected window for pediatric steroid-related behavior changes to peak, even though it does not directly measure single-pulse IVMP behavior outcomes.

Acute Cognitive and Behavioral Effects of Systemic Corticosteroids in Children Treated for Inflammatory Bowel Disease

Mrakotsky C, et al.

corticosteroidpediatricibdinflammatory-bowel-diseasecognitivebehavioralprednisoneacute-effects

Findings

Second prospective pediatric study from the Mrakotsky group, in inflammatory bowel disease rather than ALL. Confirms acute behavioral and cognitive side effects of systemic corticosteroids in children, observable on standardized instruments during active exposure. Reinforces the age-dependent pattern (younger children more affected) across non-oncology populations.

Why it may matter for Levi

Adds breadth to the preschool-vulnerability finding by showing it generalizes beyond leukemia chemotherapy regimens. Does not resolve the specific question of 3-week-post-pulse behavioral aftermath - does not follow children weeks after cessation of a single pulse. Contributes to the pattern that the pediatric corticosteroid behavior literature is dominated by during-exposure measurement, leaving post-cessation follow-up after a short IV pulse as a genuine literature gap.

Pediatric autoimmune encephalitis (clinical spectrum, first-line IVMP + oral taper, and follow-up outcomes)

Nosadini M, Mohammad SS, et al.

autoimmune-encephalitisnmdarpediatricmethylprednisolonepulseoral-taperbehavioraggressionirritabilitylong-term-outcome

Findings

Framework paper on pediatric autoimmune encephalitis plus adjacent Indian NMDAR case series (n=21). Standard first-line therapy is IV methylprednisolone 30 mg/kg/day x 3-5 days followed by oral taper at 1-2 mg/kg/day for ~12 weeks. In the Indian NMDAR series, 61.9% of children required psychotropic medication for behavioral symptoms (predominantly atypical antipsychotics - quetiapine, risperidone, olanzapine). Mean time to significant clinical behavioral response 7.4 +/- 4.8 months (range 2-19). Residual irritability and anger outbursts persisted at last follow-up in 4/21 children (3 of whom were prepubertal).

Why it may matter for Levi

Closest pediatric IVMP regimen match available in the indexed literature, but still differs from Levi's pulse-only course because it tails into a long oral taper. Confirms that in pediatric neuroinflammatory cohorts on pulse + taper regimens, ongoing behavioral difficulties in the 1-month-plus post-pulse window are common (~62% require psychotropics) and can persist for months. Cannot separate true pulse-aftermath from residual underlying disease. Does not resolve the specific 3-week-post-pulse question but confirms that pediatric neuroinflammatory patients frequently have behavioral difficulties in the 1-month-plus window.

The Pathogenesis of CSWS: Insights from the Hormonal Regulation

Kessi M, et al.

cswsdee-swaseseshpa-axisil-6growth-hormonemelatoninneuroinflammationpediatric-epilepsyhormones

Findings

Review hypothesizing that hormonal dysregulation - specifically low growth hormone, low melatonin, and elevated IL-6 - contributes to CSWS pathogenesis. Establishes a hormonal axis lens on CSWS that frames the syndrome not just as an electroencephalographic phenomenon but as one with downstream / upstream endocrine signatures. Implicates IL-6 specifically in CSWS pathogenesis - notable because IL-6 is a canonical HPA-axis activator (Papanicolaou 1998), so the neuroinflammation theory and the HPA theory converge if IL-6 is elevated.

Why it may matter for Levi

Direct link between Levi's primary syndrome (DEE-SWAS, the modern term that subsumes CSWS) and the HPA axis. Drives the new hypothalamic-hpa-axis-contribution theory in the differential and the addition of IL-6 to required cytokine panels (serum and CSF). Cross-cutting positive signal that connects the seronegative-cell-mediated-neuroinflammation theory and the hypothalamic-hpa-axis-contribution theory through a single shared analyte.

The Possible Role of Hypothalamus-Pituitary-Adrenal Dysfunction in Epileptic Spasms

Peng B, et al.

epileptic-spasmshpa-axisacthcortisolpediatric-epilepsydeeiesswest-syndrome

Findings

Review/hypothesis paper arguing that HPA-axis dysfunction is an underrecognized contributor to pediatric epileptic spasms (IESS, West syndrome). Builds the case from (a) the dramatic responsiveness of epileptic spasms to ACTH and synthetic glucocorticoids, (b) CRH/ACTH/cortisol pathway interactions with epileptogenesis in developing brain, and (c) overlap with genetic syndromes affecting hypothalamic-pituitary development. Argues that AM cortisol, ACTH, and stimulated cortisol responses are clinically underused in this population.

Why it may matter for Levi

Indirect but analogous - Levi does not have epileptic spasms, but Peng 2020 is the closest pediatric precedent for the specific logic that a steroid-responsive pediatric DEE may itself carry an HPA-axis contribution worth probing directly. The diagnostic recommendations (AM cortisol, ACTH, stimulated cortisol) transfer directly to the new diagnostic ranks 14-15. Hypothesis-generating, not definitive, for DEE-SWAS specifically.

Diagnostic criteria for the pediatric hypothalamic syndrome

van Santen HM, et al.

hypothalamic-syndromediagnostic-criteriapediatric-endocrinologyhpa-axiscircadianappetiteneurodevelopmental

Findings

Consensus diagnostic-criteria paper establishing a structured 9-domain framework for diagnosing pediatric hypothalamic syndrome - sleep/circadian, appetite/weight, body temperature, water/sodium balance, anterior pituitary axes, posterior pituitary, autonomic, behavioral, neurocognitive. Standardizes evaluation across heterogeneous etiologies (craniopharyngioma, PWS, ROHHAD, hypothalamic hamartoma, traumatic brain injury, idiopathic). Provides a defensible scoring framework for endocrinology referral.

Why it may matter for Levi

Directly drives the new diagnostic rank 20 (formal van Santen scoring exercise) and provides the structured framework against which Levi's existing phenotype is to be re-scored. Levi already meets criteria across multiple domains based on existing data (hyperphagia per April 9 phenotype profile, temperature instability, high pain threshold, sleep/circadian disruption per April 19 nocturnal addendum). Used as the lead exhibit for the new hypothalamic-hpa-axis-contribution theory.

Glucocorticoid-induced adrenal insufficiency in children: pediatric cortisol thresholds for diagnosis and recovery

Improda N, et al.

pediatric-endocrinologyhpa-axiscortisoladrenal-insufficiencyglucocorticoidsdiagnostic-thresholds

Findings

Pediatric-specific cortisol thresholds for adrenal insufficiency and HPA-axis recovery after exogenous glucocorticoid exposure. Establishes morning cortisol <150 nmol/L as adrenal insufficiency and >=317 nmol/L as recovered. Reviews glucocorticoid-induced adrenal suppression in children and provides interpretive thresholds for AM cortisol, low-dose ACTH stim, and recovery monitoring after steroid taper.

Why it may matter for Levi

Directly relevant to interpreting any AM cortisol or stimulated cortisol drawn for Levi after the March 2026 IV methylprednisolone pulse. Provides the specific pediatric thresholds used in the new diagnostic ranks 14 (AM cortisol + ACTH) and 15 (4-point salivary cortisol) and underpins the new treatment rank 15 (conditional stress-dose steroid policy). Without this paper, AM cortisol values would be interpreted against adult thresholds.

Hypoglycemia due to PI3K/AKT/mTOR signaling pathway defects: two novel cases and review of the literature

Maines E, et al.

pi3k-akt-mtorptenppp2r5dhypoglycemiamacrocephalypediatric-endocrinologyovergrowth

Findings

Case series (2 novel cases) + literature review establishing that PI3K/AKT/mTOR pathway defects cause recurrent childhood hypoglycemia alongside the better-known overgrowth/macrocephaly/DD features. Patient 1 - PTEN germline missense, macrocephaly + recurrent hypoglycemia. Patient 2 - PPP2R5D missense (Houge-Janssens / autosomal dominant ID-35), macrocephaly + hypoglycemia. Most reported cases are low-insulin (GH-like) hypoglycemia; some hyperinsulinemic. Argues PI3K-AKT-mTOR defects should be added to the differential of pediatric hypoglycemia + macrocephaly.

Why it may matter for Levi

Cross-cutting positive signal that mechanistically links the overgrowth theories (PI3K-AKT-mTOR, mosaic mTOR pathway) to the new hypothalamic-hpa-axis-contribution theory. If a PI3K-AKT-mTOR mosaic variant is identified in tissue, recurrent hypoglycemia is part of the expected phenotypic spectrum. Directly motivates the critical-sample workup at the next nocturnal awakening (diagnostic rank 18) and the structured pre-bedtime snack trial (treatment rank 12). Reframes the HPA branch as part of the overgrowth-theory phenotype rather than separate from it.

Acromegaly in a Patient with Tatton-Brown-Rahman Syndrome (DNMT3A overgrowth)

Hage M, et al.

dnmt3atbrstatton-brown-rahmanpituitary-adenomagrowth-hormoneacromegalychromatinopathycase-report

Findings

Case report of a genetically confirmed Tatton-Brown-Rahman syndrome (TBRS, DNMT3A overgrowth) patient with a GH-secreting pituitary macroadenoma presenting as acromegaly. Establishes pituitary involvement in the TBRS spectrum and provides a documented example of an endocrine-axis tumor in a chromatinopathy. Single-case evidence.

Why it may matter for Levi

Targeted positive-endocrine-overlap signal for the existing overgrowth-dnmt3a-tbrs theory. Justifies adding IGF-1 + IGF-BP3 to the new diagnostic rank 16 (hypothalamic-pituitary panel) as a specifically motivated probe if the TBRS theory stays live. Reinforces (does not change rank) - supports including IGF-1 in any future pituitary-axis screen. Also reinforces the case for explicitly enumerating the sellar/pituitary region in the neuroradiology re-read request (diagnostic rank 4).

ROHHAD syndrome: a review

Lazea C, et al.

rohhadhypothalamic-syndromehyperphagiatemperature-instabilityautonomic-dysregulationhypoventilationpediatric-endocrinologyreview

Findings

Review of ROHHAD syndrome (Rapid-Onset Obesity, Hypothalamic dysfunction, Hypoventilation, Autonomic Dysregulation). Establishes the core tetrad and the typical age of onset (1.5-7 years). Hypothalamic features include hyperphagia, temperature instability, water-balance dysregulation, and behavioral / mood disturbance. Hypoventilation is the most life-threatening feature. Etiology unknown - possibly autoimmune (anti-ZSCAN1 antibodies in some cases) or paraneoplastic (with neural crest tumors).

Why it may matter for Levi

ROHHAD-specific overlap with Levi's hyperphagia + temperature instability + autonomic features is partial - Levi has the hypothalamic features but does not (yet) have rapid-onset obesity or hypoventilation, both of which are core ROHHAD features. Lazea 2021 helps define the differential boundary - useful for ruling ROHHAD as a less-likely-but-not-excluded item in the broader hypothalamic syndrome differential, and establishes the precedent for nocturnal hyperphagia as a hypothalamic phenotype. Indirect but framing-relevant.

Impact of sleep and its disturbances on hypothalamo-pituitary-adrenal axis activity

Balbo M, Leproult R, Van Cauter E

sleephpa-axiscortisolcircadianreviewbidirectional-regulation

Findings

Review establishing sleep-HPA bidirectional regulation. Sleep disturbance (fragmentation, deprivation, phase shift) causes HPA dysregulation (flattened cortisol slope, elevated evening cortisol, exaggerated cortisol awakening response). HPA dysregulation in turn disrupts sleep architecture. Bidirectionality is mechanistically symmetric - it is not possible to interpret a flattened cortisol curve in a child with disturbed sleep as cleanly causal in either direction without longitudinal data.

Why it may matter for Levi

Foundational reference for the structured sleep diary + actigraphy diagnostic (rank 17) paired with the 4-point salivary cortisol diagnostic (rank 15) - the bidirectional framing means both the sleep-side and the cortisol-side phenotypes need to be characterized to interpret either. Drives the recommendation to time-align actigraphy and salivary cortisol collection. Underpins the sleep-hygiene treatment item (rank 13) as a standalone intervention regardless of HPA findings.

Landau-Kleffner syndrome: treatment with subpial intracortical transection

Morrell F, Whisler WW, Smith MC, et al.

landau-kleffnerlksmultiple-subpial-transectionmstrecovery-timingbehavior-before-languageparaictal-phenomenonpediatric-epilepsy-surgeryfounding-series

Findings

Founding series of 14 children with LKS treated with multiple subpial transection (MST). 7/14 (50%) recovered age-appropriate speech; 4/14 (29%) showed marked improvement. Behavior improved faster and more consistently than language, the observational seed of the paraictal-phenomenon framework later articulated explicitly by Irwin 2001. Recovery was linked to elimination of abnormal electrical discharges rather than to the structural intervention per se.

Why it may matter for Levi

Historical anchor for the claim that behavior improves before language after electrographic suppression in LKS/CSWS, which in turn frames Levi's current positive gains (eye contact, recognition, nonverbal communication, first-time fork use) as textbook paraictal-recovery behavior. Does not by itself explain the co-emergent new negatives (elopement, aggression, toileting accidents) - those require a second mechanism layered on top (developmental-age catch-up / behavioral unmasking, or post-pulse aftermath).

Multiple subpial transection in Landau-Kleffner syndrome

Irwin K, Birch V, Lees J, et al.

landau-kleffnerlksesesmultiple-subpial-transectionmstparaictal-phenomenonbehavior-before-languagerecovery-timingpediatric-epilepsy-surgery

Findings

Five children with LKS and ESES treated with MST; ESES was eliminated in all five. Behavior and seizure frequency improved dramatically and early in all five; language improvement occurred in all five but was slower to become apparent. The authors explicitly framed the timing dissociation as the paraictal-phenomenon hypothesis - behavior is tightly coupled to ongoing discharges and reverses fast, while language deficits reflect complex disruption of synaptic connections in language cortex and take longer to repair.

Why it may matter for Levi

The single clearest published statement of the paraictal-phenomenon framework, which is the primary theoretical anchor for predicting Levi's current positive-behavior trajectory after the near-total UCSF EEG. Predicts that behavior and pre-linguistic communication (eye contact, gesture, imitation, utensil use) should move first, with formal language lagging by months to years. Does not predict the emergence of new negative behaviors - those require hypothesis B (post-pulse aftermath) or A-plus (developmental-age catch-up / behavioral unmasking) to explain.

Language and behavioral outcomes of treatment with pulse-dose prednisone for electrical status epilepticus in sleep (ESES)

Hempel A, Frost M, Agarwal N

esescswsdee-swaspulse-prednisonelanguage-outcomebehavioral-outcomepediatriceeg-behavior-dissociation

Findings

Retrospective study of 17 children aged 5-10 treated with pulse-dose prednisone for ESES. 10/17 (~59%) showed language or behavior improvement. Critically, improvement was NOT significantly related to resolution of ESES on EEG and was NOT significantly related to history of regression. Lower baseline IQ predicted greater likelihood of improvement. Pulse-dose prednisone was tolerated without Cushingoid side effects.

Why it may matter for Levi

Anchors the ~6-in-10 expected behavioral/language response rate for pulse-prednisone-treated children and, most importantly for Levi's current picture, explicitly establishes that EEG improvement and behavioral improvement can dissociate in both directions. Supports the interpretation that Levi's apparently clean UCSF EEG does not require a monotonically improving behavioral trajectory, and that his currently mixed-valence behavior does not indicate EEG relapse. Frames a parent-rated behavior log as the right structured instrument for tracking his trajectory.

Continuous Spike-Waves during Slow Sleep Today: An Update

(2024 review authors)

cswsesesdee-swasreviewtreatment-responsebehavior-outcomecognitive-outcomehempel-2019-citationrelapse-rate

Findings

Modern review of CSWS/ESES/DEE-SWAS including treatment response trajectories. Pulse methylprednisolone global response rate 73% on seizures and 70% on EEG SWI with significant improvements in verbal performance, full IQ, learning and behavior, but 29% recurrence at 1 year. Topiramate: 16/18 with cognitive/behavioral improvement at 3 months, relapse in nearly half at 1 year. Cites Hempel 2019 ~59% pulse-prednisone language/behavior improvement. Explicitly states that behavioral change (hyperactivity, aggression) may persist even with EEG remission.

Why it may matter for Levi

Confirms the expected-value frame for Levi (roughly 70% EEG/clinical pulse-methylprednisolone response, ~29% 1-year relapse risk) and recognizes dissociation between EEG and behavior in both directions. Supports the current watchful-waiting plan and establishes that Levi's mixed-valence picture is a well-precedented combination, not a novel pattern requiring urgent re-evaluation.

The Penelope syndrome: A continuum of epilepsies with continuous spike-waves during slow-wave sleep

Tassinari CA, Cantalupo G, Rios-Pohl L, Della Giustina E, Rubboli G

cswsesesdee-swaspenelope-syndromesleep-consolidationpediatric

Findings

Coined the Penelope syndrome metaphor - CSWS children appear to learn by day and have that learning unwoven by nightly spike-wave activity. Canonical clinical framing of CSWS as a sleep-consolidation-interference disorder. Frames the continuum of CSWS, LKS, and atypical benign partial epilepsy under a common sleep-activated-spike-wave denominator.

Why it may matter for Levi

Pre-SHY clinical framing that, by symmetry with the post-remission renormalization finding in Bolsterli 2017, predicts restoration of overnight consolidation after Levi's EEG clearance. Load-bearing conceptual ancestor of the sleep-homeostasis mechanistic layer in the mixed-valence memo.

Impaired slow wave sleep downscaling in encephalopathy with status epilepticus during sleep (ESES)

Bolsterli BK, Schmitt B, Bast T, Critelli H, Heinzle J, Jenni OG, Huber R

esescswsdee-swasslow-wave-downscalingsleep-homeostasispediatric

Findings

Original demonstration that the normal overnight decrease in NREM slow-wave slope - the Tononi-Cirelli signature of synaptic downscaling - is abolished in children with active ESES, with spatial co-localization to spike-wave regions. Establishes ESES as a sleep-homeostasis disorder at the circuit level, not just a seizure disorder.

Why it may matter for Levi

Pre-remission anchor in the three-paper Bolsterli arc. Grounds the claim that Levi's pre-pulse EEG state was pathologically interfering with overnight consolidation.

Remission of encephalopathy with status epilepticus (ESES) during sleep renormalizes regulation of slow wave sleep

Bolsterli BK, Gardella E, Pavlidis E, Wehrle FM, Tassinari CA, Huber R, Rubboli G

esescswsdee-swassleep-homeostasisrecovery-mechanismpediatric

Findings

Demonstrates that the overnight slow-wave downscaling impairment observed during active ESES is reversible - it renormalizes when ESES resolves. Completes the pre/during/post arc with Bolsterli 2011. Severity of neuropsychological compromise correlates with extent of slow-wave alteration during active phase.

Why it may matter for Levi

Post-remission mechanistic anchor for the positive half of Levi's mixed-valence picture. The UCSF EEG clearance predicts that Levi's overnight synaptic-downscaling machinery has resumed, which is the substrate for new-skill consolidation (fork use, eye contact, recognition, nonverbal communication, possible language).

Sleep slow-wave homeostasis and cognitive functioning in children with electrical status epilepticus in sleep

Van den Munckhof B, et al.

cswsesesdee-swassleep-homeostasiscognitionbehaviorpediatric

Findings

Cross-sectional demonstration that the magnitude of overnight slow-wave downscaling impairment in children with ESES correlates with the severity of cognitive and behavioral compromise. Makes the Bolsterli biomarker mechanistically meaningful.

Why it may matter for Levi

Empirical cognition-behavior coupling that supports interpreting Levi's new consolidation gains as mechanistically expected rather than surprising after his EEG clearance.

Sleep and the price of plasticity: from synaptic and cellular homeostasis to memory consolidation and integration

Tononi G, Cirelli C

synaptic-homeostasis-hypothesisshysleep-homeostasistheoretical-framework

Findings

Canonical statement of the Synaptic Homeostasis Hypothesis (SHY). Proposes that NREM slow-wave activity renormalizes synaptic strength accumulated during wake; waking drives net potentiation (learning), NREM drives net downscaling (consolidation-preserving selective renormalization). Provides the theoretical backbone for the entire Bolsterli / Van den Munckhof ESES arc.

Why it may matter for Levi

Theoretical framework that makes the Levi-specific prediction - EEG clearance restores overnight downscaling, which restores consolidation capacity, which produces new-skill gains - explicit and mechanistic rather than just correlational.

Focal sleep spindle deficits reveal focal thalamocortical dysfunction and predict cognitive deficits in sleep activated developmental epilepsy

Kramer MA, Stoyell SM, Chinappen D, et al., Chu CJ

cswsesesdee-swassleep-spindlesthalamocorticalbiomarkerpediatric

Findings

In children with sleep-activated developmental epilepsy, focal sleep-spindle deficits anatomically co-localize with the epileptic focus and predict the degree of cognitive impairment. Provides a mechanistically interpretable thalamocortical-circuit biomarker for the cognition-consolidation coupling.

Why it may matter for Levi

Foundational Chu-group paper in the spindle-biomarker arc. Supports the case for follow-up sleep EEG with explicit spindle quantification as a biomarker of consolidation-capacity recovery in Levi after his EEG clearance.

High-dose diazepam treatment in continuous spike and wave during sleep: case report linking sleep-spindle recovery to cognitive improvement

Stoyell SM, et al., Chu CJ

cswsesesdee-swasdiazepamsleep-spindlesrapid-responsecase-reportcitation-correction

Findings

Single-case demonstration that high-dose diazepam restored sleep spindles on the first night of treatment in a child with CSWS, with concurrent cognitive improvement. Translates the Kramer/Chu spindle-deficit biomarker into a therapeutic-response-window demonstration.

Why it may matter for Levi

CITATION CORRECTION - the user-supplied 2026-04-19 report referenced 'Sanchez Fernandez Pediatr Neurol 2013' for the 24-hour treatment-response-window claim; the best match for that claim is this Stoyell/Chu 2021 BMC Neurology paper. Supports the interpretation that rapid behavioral and cognitive gains after successful CSWS-directed treatment are mechanistically plausible when the sleep-EEG substrate is actually corrected.

Post-traumatic confusional state: A case definition and diagnostic criteria

Sherer M, Katz DI, Bodien YG, et al., Giacino JT

neurorehabilitationpost-traumatic-confusional-staterecovery-of-consciousnessagitationcross-diagnostic-analogy

Findings

ACRM Disorders of Consciousness task force consensus case definition for Post-Traumatic Confusional State (PTCS) - the transitional recovery state after emergence from MCS in which returning goal-directed behavior and prominent agitation/disinhibition/behavioral-dysregulation co-occur as two faces of the same recovery step. Time-limited; resolution is a prerequisite for higher functional recovery.

Why it may matter for Levi

Cross-diagnostic vocabulary for interpreting Levi's mixed-valence picture as a recognized recovery phase, not a paradox. Predicts attenuation of the negative features as the transitional phase resolves, supporting conservative watchful-waiting management.

eMCS emergence and confusional state (Bodien and Giacino 2020)

Bodien YG, Giacino JT

neurorehabilitationdisorders-of-consciousnessemergence-mcsagitationcross-diagnostic-analogy

Findings

Establishes the quantitative expectation that emergence from minimally conscious state is typically followed by a confusional, agitated phase with agitation rates commonly reported around 69 percent. Confusion and agitation are not predictive of worse long-term outcome in an otherwise-favorable trajectory.

Why it may matter for Levi

Supplies the high-double-digit agitation-prevalence anchor for the cross-diagnostic neurorehabilitation framing of Levi's new negatives. Reinforces mixed-valence as statistically expected rather than paradoxical.

Agitated behaviors following traumatic brain injury: A systematic review and meta-analysis

Phyland RK, Ponsford JL, Carrier SL, Hicks AJ, McKay A

neurorehabilitationagitationtraumatic-brain-injurymeta-analysiscross-diagnostic-analogy

Findings

Systematic review and meta-analysis of 44 studies. Pooled agitation prevalence across all recovery stages 31.73 percent; 44 percent among patients still in post-traumatic amnesia (PTA). Agitation resolves as PTA resolves in most cases and is not associated with worse long-term outcome when managed appropriately.

Why it may matter for Levi

Quantitative prior that the closest cross-diagnostic analogue (acute post-injury recovery) sees agitation in roughly one-in-three overall and nearly half during active post-injury confusion. Levi's current mild agitation features are therefore statistically expected, not a red flag.

Agitation as a clinical sign of recovery of consciousness (Frontiers in Surgery PMC8097005)

Wang et al.

neurorehabilitationagitationrecovery-of-consciousnesscitation-correctioncross-diagnostic-analogy

Findings

Reframes behavioral agitation after acute brain injury as a clinical sign of recovering consciousness - returning arousal and drive in the context of persistent cognitive/executive impairment produces agitation phenomenology. Argues for environmental management before pharmacologic sedation.

Why it may matter for Levi

CITATION CORRECTION - the user-supplied 2026-04-19 report mis-cited this paper as 'Lombard et al. Frontiers in Neurology PMC8097005'. The PMC ID is correct, the authors and journal are not. Supports the interpretation that Levi's new negatives are mechanistically coupled to his new positives through the same returning-drive mechanism.

Disinhibition, a circuit mechanism for associative learning and memory

Letzkus JJ, Wolff SBE, Luthi A

disinhibitionassociative-learningcircuit-neurosciencetheoretical-framework

Findings

Reviews cortical disinhibition - typically via VIP-interneuron-mediated suppression of PV and SST interneurons - as a robust circuit-level mechanism for associative learning. Multiple neocortical learning paradigms require disinhibition windows. The same synaptic dynamics that enable plasticity also increase susceptibility to distraction and stimulus-driven behavior.

Why it may matter for Levi

Circuit-level theoretical backbone for the claim that the same neural process producing Levi's new learning also produces the behavioral features that look like disinhibition. Predicts that the disinhibition features should attenuate as executive modulation catches up to the plastic substrate.

Acquired aphasia, dementia, and behavior disorder with epilepsy and continuous spike-and-waves during sleep in a child

Roulet-Perez E, Davidoff V, Despland PA, Deonna T

cswsesesacquired-epileptic-frontal-syndromebehavior-regressionpediatric

Findings

Canonical early description of acquired aphasia, cognitive regression, and behavior disorder in a child with CSWS. Establishes that CSWS-era behavioral/frontal dysregulation is part of the phenotype itself rather than an incidental comorbidity. Foundational reference for what was later called acquired epileptic frontal syndrome.

Why it may matter for Levi

Historical-clinical grounding for interpreting Levi's pre-pulse behavioral dysregulation as part of the CSWS/DEE-SWAS phenotype, and recovery of the behavioral axis as a meaningful outcome alongside language recovery.

Long-term outcome after cognitive and behavioral regression in nonlesional epilepsy with continuous spike-waves during slow-wave sleep

Seegmuller C, Deonna T, Dubois CM, et al., Metz-Lutz MN

cswseseslong-term-outcomecognitive-recoverybehavioral-recoveryquote-verification-pendingpediatric

Findings

Longitudinal follow-up of children with non-lesional CSWS who had undergone cognitive and behavioral regression. Confirms meaningful long-term cognitive and behavioral improvement after CSWS resolution but emphasizes that residual deficits often persist, particularly in executive function and attention domains.

Why it may matter for Levi

Long-horizon prognostic counter-weight. Reinforces continued high-quality neuropsychological follow-up over years, not just weeks. NOTE - the verbatim quote the user-supplied 2026-04-19 report attributed to this paper could not be found in the PubMed abstract and should be treated as paraphrase pending full-text access.

Subclinical 'electrical status epilepticus' induced by sleep in children

Patry G, Lyagoubi S, Tassinari CA

esescswshistoricaloriginal-descriptionpediatric

Findings

Original description of the near-continuous spike-wave pattern during non-REM sleep in children that was later named ESES and became the electrographic substrate for DEE-SWAS. Coined the term 'subclinical electrical status epilepticus induced by sleep' and documented the dissociation between sleep-activated electrographic status and daytime clinical seizure semiology.

Why it may matter for Levi

Historical anchor only; no direct clinical bearing on Levi's management. Useful when explaining to new providers that DEE-SWAS is a well-characterized, decades-old syndrome rather than a novel diagnosis.

Sleep function and synaptic homeostasis

Tononi G, Cirelli C

synaptic-homeostasis-hypothesisshysleep-homeostasistheoretical-framework

Findings

Earlier (2006) statement of the Synaptic Homeostasis Hypothesis (SHY). Predecessor to the more fully developed 2014 Neuron paper already in the corpus. Proposes sleep-associated slow-wave activity as the mechanism that renormalizes synaptic strength potentiated during wake; impaired downscaling degrades new learning.

Why it may matter for Levi

Completeness reference for the SHY framework; the 2014 Neuron article (tononi-cirelli-2014-synaptic-homeostasis-hypothesis) remains the canonical citation.

Perinatal thalamic injury: MRI predictors of electrical status epilepticus in sleep and long-term neurodevelopmental outcomes

van den Munckhof B, et al.

esesdee-swasperinatal-thalamic-injurymristructural-etiology

Findings

Cohort of children with perinatal thalamic injury; a substantial subset developed ESES. MRI features (lesion size, bilaterality, thalamocortical tract involvement) predicted ESES progression. Reinforces thalamocortical circuit disruption as a core pathogenic axis even for small primary lesions.

Why it may matter for Levi

Levi's April 2026 MRI shows no thalamic injury, no hemorrhage, and normal hippocampi. Reinforces the Viswanathan 2024 finding that structural DEE-SWAS clusters on the thalamocortical network and supports Levi's placement in the structurally-unremarkable majority. The specialized pediatric neuroradiology re-read should specifically evaluate subtle thalamocortical connectivity features.

Early thalamic lesions in patients with sleep-potentiated epileptiform activity

Sánchez Fernández I, Takeoka M, Tas E, et al.

esesdee-swasthalamic-lesionstructural-etiologymri

Findings

Foundational cohort identifying early (perinatal) thalamic lesions - hemorrhage, stroke, and other perinatal injuries - as a recurring structural substrate for sleep-potentiated epileptiform activity. Supports the thalamocortical-disruption model rather than a pure cortical-lesion model.

Why it may matter for Levi

Additional structural-etiology evidence that does not describe Levi's imaging. Does not alter the differential; reinforces the priority of mosaic-sensitive genetic testing over further structural workup.

The genetic landscape of developmental and epileptic encephalopathy with spike-and-wave activation in sleep

Freibauer AE, et al.

dee-swasgeneticsgrin2acnksr2review

Findings

Review of DEE-SWAS genetic architecture. GRIN2A is the most common single-gene cause; CNKSR2 (X-linked scaffolding protein) produces severe epilepsy-aphasia phenotypes; ZEB2, 17q21.31 deletions, and other genes contribute smaller proportions. Approximately 18% genetic, 43% structural/metabolic, 39% unknown etiology on standard workup.

Why it may matter for Levi

Quantifies the prior: only ~18% of DEE-SWAS is germline single-gene. Levi's three negative germline workups are therefore a weaker 'rule-out' than the raw negative result suggests and support extending to mosaic-sensitive tissue-based testing. GRIN2A coverage should be confirmed in prior reports.

CNKSR2 mutation causes the X-linked epilepsy-aphasia syndrome: A case report and review of literature

Sun Y, et al.

cnksr2x-linkedepilepsy-aphasia-syndromedee-swas

Findings

Case + literature review establishing CNKSR2 (X-linked postsynaptic scaffolding protein on Xp22.12) as a monogenic cause of severe epilepsy-aphasia phenotypes within the DEE-SWAS spectrum. Patients show especially severe neurodevelopmental course.

Why it may matter for Levi

Levi is XY; a hemizygous X-linked CNKSR2 variant would manifest. Confirm CNKSR2 coverage in Levi's prior sequencing before deprioritizing; CNKSR2 belongs on any mosaic-sensitive tissue-based DEE-SWAS panel.

Serum inflammatory mediators correlate with disease activity in electrical status epilepticus in sleep (ESES) syndrome

van den Munckhof B, et al.

esesdee-swasneuroinflammationcytokinesil-6immunomodulation

Findings

Serum IL-1α, IL-6, IL-10, and TNF-α elevated in ESES patients vs. healthy controls. Successful immunomodulatory treatment associated with IL-6 decrease that correlated with both EEG and neuropsychological improvement. Supports an active role for inflammatory mediators as drivers of disease activity, not merely biomarkers.

Why it may matter for Levi

Direct external support for the hypothesis that Levi's April 2026 Th1/Th17-weighted cytokine signature reflects biologically active neuroinflammation contributing to his DEE-SWAS rather than an incidental finding. Normal WBC and undetectable hsCRP do not exclude a meaningful cytokine-level immune signal. Reinforces adding IL-6 to every future serum and CSF cytokine panel. Mechanistic basis for why corticosteroids and IVIG work in DEE-SWAS.

Treatment of electrical status epilepticus in sleep: A pooled analysis of 575 cases

van den Munckhof B, et al.

esesdee-swastreatmentcorticosteroidspooled-analysis

Findings

Landmark pooled analysis of 575 ESES cases. Response rates: surgery ~90%, corticosteroids ~81%, benzodiazepines ~68%, sulthiame ~53%, levetiracetam ~54%, standard ASMs ~49%. Oxcarbazepine and carbamazepine can worsen spike-wave index and should be avoided.

Why it may matter for Levi

Primary-source underpinning for Levi's treatment hierarchy, previously cited via the Kotagal 2017 review. Quantitatively supports the March 2026 IV methylprednisolone pulse-first strategy (81% response). The avoid-oxcarbazepine/carbamazepine signal should be confirmed communicated to Stanford and UCSF epileptology. Response rates are for initial response, not durability.

Landau-Kleffner syndrome and CSWS syndrome: Treatment with intravenous immunoglobulins

Arts WFM, Aarsen FK, Scheltens-de Boer M, Catsman-Berrevoets CE

iviglandau-kleffner-syndromecswsdee-swasimmunomodulation

Findings

Early observational evidence that IVIG produces meaningful cognitive and EEG improvement in LKS and CSWS, particularly when recurrent viral illnesses seem to exacerbate the condition. Foundational citation for the immune-mediated model of DEE-SWAS.

Why it may matter for Levi

Historical anchor supporting IVIG as a contingent steroid-sparing option if Levi relapses off steroids and a humoral/immune driver remains plausible. Complements the 2023 Saudi multicenter IVIG study already in the corpus. Belongs on the contingent-immunomodulation tier, not first-line.

Immediate termination of electrical status epilepticus in sleep after hemispherotomy is associated with significant progress in language development

Groppel G, et al.

esesdee-swashemispherotomyepilepsy-surgerylanguage-recovery

Findings

Patients with unilateral structural etiology underwent hemispherotomy with immediate post-surgical ESES resolution and significant gains in language development. Supports the thalamocortical-disconnection model - breaking the aberrant bilateral projection stops spike-wave activity and reopens the developmental substrate.

Why it may matter for Levi

Levi is not a surgical candidate (structurally unremarkable MRI; no unilateral resectable lesion). Paper is relevant as mechanistic evidence that rapid suppression of sleep-activated spike-wave - by any mechanism - reopens the developmental window quickly; supports aggressive medical suppression in Levi's non-surgical case.

Ketogenic diet-produced β-hydroxybutyric acid accumulates brain GABA and increases GABA/glutamate ratio to inhibit epilepsy

Qiao YN, et al.

ketogenic-dietbeta-hydroxybutyrategabamechanismepilepsy

Findings

β-hydroxybutyrate (β-HB) accumulates in the brain during ketogenic-diet ketosis, increases brain GABA, and raises the GABA/glutamate ratio. Provides direct molecular mechanism for ketogenic-diet anti-epileptic effect, plus mechanistic grounding for reported neuroprotective and anti-inflammatory properties.

Why it may matter for Levi

Keeps ketogenic diet as a valid fall-back option if corticosteroid durability is limited and the next tier (benzodiazepines, sulthiame, IVIG) is insufficient. Mechanism is complementary to (not overlapping with) steroid immunomodulation; ketogenic failure would not carry interpretive weight for the neuroinflammation hypothesis.

Effects of sulthiame on seizure frequency and EEG in children with electrical status epilepticus during slow sleep

Topçu Y, et al.

sulthiameesesdee-swascarbonic-anhydrase-inhibitor

Findings

Pediatric cohort of ESES children treated with sulthiame (carbonic anhydrase inhibitor widely used in Europe). Reduction in seizure frequency and EEG spike-wave index in a meaningful subset, consistent with the ~53% response rate reported in the Kotagal 2017 pooled review. Generally well-tolerated.

Why it may matter for Levi

Option to raise with Levi's epileptologist if the March 2026 steroid pulse response is not durable. US availability is limited and would require special access or coordination. Supports the current treatment-rank placement of sulthiame as a second-tier non-steroid option.

Fenfluramine for developmental and epileptic encephalopathy with spike-wave activation in sleep (DEE-SWAS): An exploratory study

Parra-Díaz P, et al.

fenfluraminedee-swasserotonergicexploratorynovel-therapy

Findings

Early exploratory evidence that fenfluramine (serotonergic agent FDA-approved for Dravet and Lennox-Gastaut) reduces spike-wave index in a majority of treated DEE-SWAS patients. First study testing a mechanistically distinct non-immunomodulatory, non-benzodiazepine option for DEE-SWAS.

Why it may matter for Levi

Adds a mechanistically distinct option to Levi's contingent treatment list, relevant if steroid response is not durable and standard fallbacks are exhausted. Cardiac safety (historical valvular / pulmonary-hypertension associations) requires baseline cardiology workup including a cooperative repeat EKG (still outstanding). Complements the Datta 2026 CBD case report as a non-standard DEE-SWAS option worth tracking.

Long-term outcome of 32 children with encephalopathy with status epilepticus during sleep, or ESES syndrome

Liukkonen E, Kantola-Sorsa E, Paetau R, Gaily E, Peltola M, Granström ML

esescswslong-term-outcomepediatricprognosis

Findings

Prospective 32-child cohort with ESES followed long-term. EEG abnormalities and clinical seizures typically remitted; a substantial fraction retained meaningful cognitive and behavioral deficits. Earlier onset and longer duration of active ESES associated with worse outcomes.

Why it may matter for Levi

Reinforces the imperative of minimizing active-disease duration in Levi. The April 2026 electrographic resolution is favorable; the depth of regression and probable long pre-diagnosis active period are counterweights. Supports durability-of-suppression emphasis and high-intensity developmental therapy during the current window.

Intelligence outcomes in 17 patients with developmental and/or epileptic encephalopathy with spike-wave activation in sleep ((D)EE-SWAS) after remission of SWAS

van Arnhem MML, et al.

dee-swasiq-outcomelongitudinalrecovery-trajectoryage-of-onsetprognosis

Findings

Longitudinal IQ outcomes in 17 (D)EE-SWAS patients after SWAS remission. Mean IQ drop during active phase >20 points. Two post-remission trajectories: partial-recovery group (~half) gained 15.9 IQ points on average; continued-decline group (~half) lost a further 8.1 points on average despite EEG remission. Continued-decline group characterized by significantly earlier age of SWAS onset.

Why it may matter for Levi

Most relevant published prognostic reference for Levi. Regression began around age 2.5; probable long pre-diagnosis active SWAS period places Levi closer to the earlier-onset risk stratum. Two action priorities: (1) serial formal neuropsychological testing to characterize Levi's actual trajectory rather than relying on developmental progress notes alone; (2) keep electrographic-suppression durability at high priority since the continued-decline group suffered further loss despite EEG remission.

Encephalopathy with status epilepticus during sleep or continuous spikes and waves during slow sleep syndrome: a multicenter, long-term follow-up study of 117 patients

Caraballo RH, et al.

esescswslong-term-outcomemulticenterprognosis

Findings

Multicenter long-term follow-up of 117 CSWS / ESES patients. Broad etiology distribution; persistent cognitive and/or behavioral sequelae in a majority despite EEG/seizure remission. Etiology-stratified prognosis: structural + surgery → better outcomes; unknown / genetic → worse outcomes.

Why it may matter for Levi

Quantitatively reinforces Liukkonen 2010: electrographic remission does not guarantee developmental recovery. Levi's structurally unremarkable MRI combined with three negative germline workups places him in the harder-prognosis population unless a mosaic or epigenetic diagnosis opens a targeted-therapy path. Underscores the priority of mosaic-sensitive PROS panel and methylation / episignature panel.

mTORopathies in Epilepsy and Neurodevelopmental Disorders: The Future of Therapeutics and the Role of Gene Editing

Boff MO, et al.

mtoropathypi3k-akt-mtorgene-editingrapamycineverolimusprecision-medicinereview

Findings

Recent review of mTORopathy therapeutic landscape - rapalogs (rapamycin, everolimus), targeted gene editing, emerging precision therapies. mTOR inhibitors attenuate neuroinflammation in addition to seizure reduction, linking the mTORopathy and neuroinflammation mechanisms.

Why it may matter for Levi

Directly relevant to the leading mosaic PI3K-AKT-mTOR hypothesis. A confirmed molecular diagnosis in the mTOR axis would open actionable precision therapy (rapalogs FDA-approved in TSC; alpelisib approved for PROS). mTOR-pathway-driven neuroinflammation is consistent with Levi's April 2026 cytokine signature - mechanistically linking two of Levi's leading hypotheses. Gene editing is investigational and not a near-term option but worth long-horizon tracking.

Brain overgrowth in disorders of RTK-PI3K-AKT signaling: a mosaic of malformations

Hevner RF

brain-overgrowthrtk-pi3k-aktsomatic-mosaicismmtoropathyreview

Findings

Pediatric neuropathology review of the brain-overgrowth spectrum produced by RTK-PI3K-AKT pathway dysregulation. Reviews somatic-mosaicism distribution as primary determinant of spectrum location. Macrocephaly-ASD connection - the PI3K-AKT-mTOR pathway is implicated in a large fraction (approaching half) of macrocephalic ASD cases.

Why it may matter for Levi

Complementary framing to Mirzaa & Poduri 2014 for the mosaic PI3K-AKT-mTOR hypothesis. Symmetric proportional overgrowth + DEE-SWAS + normal MRI (as in Levi) is consistent with a low-VAF somatic variant whose tissue distribution does not produce a visible structural malformation. Supports the mosaic-sensitive tissue-based PROS panel as the single highest-yield next genetics step. NOTE - the PMC ID (PMC4268391) cited in the source report is the same PMC ID used by the Mirzaa & Poduri 2014 record already in the corpus; full-text verification recommended to confirm this is a distinct paper.

Disruption of mTORC1 rescues neuronal overgrowth and synapse function disturbed by loss of PTEN

Tariq K, et al.

ptenmtorc1synaptopathyrapamycinmechanism

Findings

Mechanistic study demonstrating that mTORC1 disruption rescues neuronal overgrowth and synaptic dysfunction in the context of PTEN loss. Identifies mTORC1 as sufficient to mediate the PTEN-loss phenotype and a viable therapeutic target.

Why it may matter for Levi

Strengthens the rapalog rationale if a PTEN or PI3K-AKT-mTOR variant is identified in Levi. Complementary to Lasser 2024 - Tariq argues mTORC1-alone targeting is sufficient while Lasser argues dual mTORC1/mTORC2 may outperform. Both positions would inform precision-therapy selection and would need to be weighed against the specific variant identified. Empiric rapamycin without molecular confirmation remains unsupported.

Mechanisms of brain overgrowth in autism spectrum disorder with macrocephaly

Currey L, et al.

autismmacrocephalybrain-overgrowthpi3k-akt-mtorchd8review

Findings

Review of molecular mechanisms underlying macrocephaly-ASD, with PI3K-AKT-mTOR as a major mechanistic hub. The pathway is implicated in nearly half of macrocephalic ASD cases. Additional genes (CHD8, PTEN, TSC1/2) contribute to the broader landscape.

Why it may matter for Levi

Quantitative prior for the macrocephaly-ASD-mTOR association. Levi is at the 99th percentile for head circumference from ~12 months with ASD and DEE-SWAS - phenotype matches the population discussed. Supports keeping mosaic PI3K-AKT-mTOR at the top of Levi's differential despite three negative germline workups and structurally unremarkable MRI. Reinforces mosaic-sensitive PROS panel + methylation / episignature panel for CHD8 and related chromatinopathies.

Somatic overgrowth predisposes to seizures in autism spectrum disorders

Valvo G, et al.

autismsomatic-overgrowthtall-staturemacrocephalyseizuresbiomarker

Findings

Clinical cohort establishing somatic overgrowth (tall stature and/or macrocephaly) as a phenotypic biomarker for seizure susceptibility in idiopathic ASD. Tall stature even without macrocephaly significantly associated with EEG abnormalities and later-onset seizures; combined with macrocephaly strongly predicts early-onset seizures. In ASD, seizure presence associates most tightly with severe intellectual disability rather than core ASD severity.

Why it may matter for Levi

Direct external support for the clinical association between Levi's overgrowth phenotype (99th percentile height and HC from ~12 months) and his eventual seizure phenotype (DEE-SWAS). Not a coincidence - a documented clinical association. Reinforces priority of identifying the underlying mechanism (mosaic PI3K-AKT-mTOR, chromatinopathy, imprinting) that explains the overgrowth, rather than treating overgrowth and DEE-SWAS as independent findings.

Shared etiology in autism spectrum disorder and epilepsy with functional disability

Zahra A, et al.

autismepilepsyshared-etiologyexcitation-inhibition-balancereview

Findings

Review of shared genetic and mechanistic landscape between ASD and epilepsy. Ion channel genes (SCN1A, SCN2A, SCN8A), synaptic scaffolding (SHANK3), and multiple chromatin and mTOR-axis genes are shared. Central shared mechanism is excitation/inhibition imbalance, often via GABAergic dysfunction. Mechanism recognition enables mechanism-aware drug selection.

Why it may matter for Levi

Conceptual scaffold for approaching Levi's ASD-plus-DEE-SWAS as a single-etiology problem. Consistent with Viswanathan 2024 clustering of DEE-SWAS genes into ion-channel/scaffolding and chromatin/transcriptional networks - both networks are high-recurrence in ASD. Reinforces that identifying Levi's underlying lesion is expected to inform both the epilepsy treatment and the ASD developmental trajectory.

Modulation of neuroinflammation as a therapeutic strategy in epilepsy

Ramos AJ, et al.

neuroinflammationepilepsytherapeutic-strategymtor-inhibitionreview

Findings

Review of neuroinflammation as a therapeutic target in epilepsy. IL-1β, IL-6, TNF-α and microglial activation are active in many epilepsies. Therapeutic options include corticosteroids, IVIG, and mTOR inhibitors (which attenuate neuroinflammation in addition to reducing seizures). Links the mTORopathy and neuroinflammation hypotheses.

Why it may matter for Levi

Consolidates the argument that Levi's April 2026 cytokine signature is a legitimate therapeutic target, not just a biomarker. If an mTOR-axis variant is ever confirmed, rapalog therapy would address both the direct mTOR lesion and the downstream neuroinflammation - a two-for-one mechanism. Keeps neuroinflammation as an active hypothesis for repeat CSF cytokine measurement in the planned repeat LP.

Cannabidiol (CBD) and cognition in epilepsy

Gaston TE, et al.

cannabidiolcbdcognitionepilepsyanti-inflammatory

Findings

Review of CBD's effects on cognition in epilepsy. CBD suppresses neuronal excitability while providing neuroprotective and anti-inflammatory benefits. Cognitive effects are neutral to modestly beneficial - CBD does not carry the cognitive-burden profile of many traditional ASMs. Mechanisms include endocannabinoid modulation, inflammatory signaling suppression, and potential antioxidant effects.

Why it may matter for Levi

Plausible contingent treatment option for Levi, particularly if (a) TBRS or another chromatinopathy is ever confirmed (per Datta 2026), (b) the immune-inflammatory hypothesis continues to carry weight, and (c) conventional ASM escalation is needed. CBD (Epidiolex) has FDA approval in TSC, Dravet, and LGS - not specifically DEE-SWAS - so use in Levi would be off-label. Cognition-neutral profile is a meaningful advantage over traditional ASMs for long-term maintenance.

Do children really recover better? Neurobehavioural plasticity after early brain insult

Anderson V, Spencer-Smith M, Wood A

neuroplasticitypediatric-brain-injurykennard-principlecritical-periodreview

Findings

Critical review of the Kennard principle - the oversimplified claim that children always recover better from brain injury. Early and prolonged insults can disrupt critical developmental periods and produce deficits that compound rather than resolve. Neural plasticity is bounded; recovery depends on insult timing, duration, and relationship to developmental windows.

Why it may matter for Levi

Tempers optimism about the April 2026 electrographic resolution - clean EEG is necessary but not sufficient for developmental recovery. Duration of active DEE-SWAS (possibly >1 year) may have disrupted critical developmental windows in ways plasticity cannot fully reverse. Consistent with van Arnhem 2025 finding that ~half of post-remission patients experience further cognitive decline. Supports high-intensity multidisciplinary developmental therapies during the current window and long-horizon neuropsychological follow-up. Useful family-facing framing reference.

Neurohabilitation of cognitive functions in pediatric epilepsy

Zaldumbide-Alcocer FL, et al.

neurorehabilitationcognitive-rehabilitationpediatric-epilepsyexecutive-functionreview

Findings

Review of cognitive rehabilitation strategies for children with epilepsy - computerized cognitive training, structured interventions, family-centered multidisciplinary models. Supports extending DEE-SWAS treatment beyond seizure/spike-wave suppression into active cognitive rehabilitation during electrographic-improvement windows.

Why it may matter for Levi

Framework for extending Levi's current therapy stack (ABA, speech, OT, AAC) with structured cognitive rehabilitation targets. Supports planning formal neuropsychological assessment once Levi's attention and engagement are sufficient to make testing meaningful. Reinforces family-centered, integrated-environment rehabilitation rather than siloed therapy appointments. Useful reference for conversations with Levi's developmental pediatrician and BCBA team.

Enhancing executive functions in pediatric epilepsy

Tapia JL, et al.

executive-functionpediatric-epilepsycognitive-rehabilitationreview

Findings

Review of interventions to enhance executive functioning in children with epilepsy. Executive function deficits are common in pediatric epilepsy and contribute significantly to functional impairment beyond seizure frequency. Targeted interventions (computerized training, structured therapies) can enhance executive function measurably. Early intervention during electrographic-stability periods produces better gains.

Why it may matter for Levi

Supports scaling up cognitive-focused rehabilitation during Levi's current window of electrographic suppression. Executive function is likely to be a persistent deficit domain for Levi based on the Liukkonen 2010, Caraballo 2013, Seegmuller 2012, and van Arnhem 2025 long-term outcome literature - active remediation during the current window is more tractable than after further decline. Useful for planning specific therapy goals (attention, task-switching, working memory) alongside AAC language scaffolding.

Adaptive neuroplasticity in brain injury recovery: strategies and insights

Zotey V, et al.

neuroplasticitybrain-injury-recoveryrehabilitationmultidisciplinary-carefamily-centered-carereview

Findings

Review of strategies for harnessing adaptive neuroplasticity in brain injury recovery, including multidisciplinary family-centered rehabilitation models. Optimal outcomes emerge from integrated multidisciplinary care combined with family engagement; environmental enrichment and sustained progressive intervention produce better outcomes than episodic or single-domain approaches.

Why it may matter for Levi

Broad framework for the integrated rehabilitation approach Jake and Miki already run (ABA, speech, OT, AAC, developmental pediatrics, BCBA coordination). Reinforces that recovery from DEE-SWAS-driven regression is not passive - it requires active, sustained, integrated rehabilitation during the window of electrographic suppression. Aligns with Anderson 2011 in emphasizing plasticity is bounded and rehabilitation quality materially affects outcomes.

International League Against Epilepsy classification and definition of epilepsy syndromes with onset in childhood: Position paper by the ILAE Task Force on Nosology and Definitions

Specchio N, Wirrell EC, Scheffer IE, et al.

ilaedee-swasnosologyclassificationposition-paper

Findings

Canonical ILAE 2022 position paper formally introducing the DEE-SWAS / EE-SWAS nomenclature and replacing older ESES/CSWS terms. Establishes SWI threshold framing, etiology stratification, and the developmental-vs-non-developmental axis now used across the field.

Why it may matter for Levi

The reference document for why Levi is classified as DEE-SWAS rather than EE-SWAS (pre-existing global delay before SWAS onset) and for the language Stanford/UCSF use in clinic notes. Foundational for every downstream 2022+ DEE-SWAS paper in the corpus.

Rebuilding the Tower of Babel: The Current Landscape of DEE-SWAS

Stowe RC, et al.

dee-swasnosologyreviewcurrent-landscape

Findings

Current-landscape review. Despite 2022 ILAE standardization, DEE-SWAS groups continue using variable SWI thresholds, treatment algorithms, and outcome measures. Consolidation around IV pulse steroids, benzodiazepines, and (in eligible cases) surgery is emerging but incomplete. Recommends standardization of SWI quantification and trial inclusion criteria.

Why it may matter for Levi

Background context for why different providers describe Levi's syndrome with slightly different vocabularies and why protocols vary across centers. Supports framing Levi's care as 'reasonable-range' rather than 'protocol-deviant' for the steroid taper duration and ASM selection choices.

Developmental and Epileptic Encephalopathy with Spike-and-Wave Activation in Sleep and Infantile Epileptic Spasms Syndrome: 2026 update

Lapid Varughese S, et al.

dee-swasiessreview2026

Findings

2026 update on DEE-SWAS and IESS covering etiology stratification, EEG criteria, treatment response rates, and long-term outcomes. Incorporates post-2022-ILAE evidence and newer therapeutic options (fenfluramine, expanded mTOR inhibitor use).

Why it may matter for Levi

Most current 2026 synthesis of DEE-SWAS and IESS. Worth full-text review when accessible to calibrate Levi's management against 2026 standards. Likely reinforces existing priorities (IV pulse steroids, genetic workup including mosaicism, specialized neuroradiology re-read).

Developmental and epileptic encephalopathy with spike-wave activation in sleep: a tertiary-center cohort

Hanci F, et al.

dee-swascohorttertiary-center2026

Findings

Tertiary pediatric neurology center cohort of DEE-SWAS patients. Reports etiology distribution, SWI quantification, treatment response patterns, and outcomes. Cited twice in the 2026 Manus AI review (refs [4] and [6]).

Why it may matter for Levi

Contemporary 2026 cohort data provides benchmark for Levi's case. Useful for comparing his etiology-unknown status, treatment response (near-total electrographic resolution on IV pulse), and likely prognostic trajectory against a recent real-world cohort.

Ethosuximide in developmental and epileptic encephalopathy with spike-wave activation in sleep

Ng ACH, et al.

ethosuximidedee-swasasmtreatment2026

Findings

Study of ethosuximide as an ASM option in DEE-SWAS. Explores response rates, EEG effects (SWI reduction), tolerability, and position within the DEE-SWAS treatment algorithm.

Why it may matter for Levi

Ethosuximide is not currently on Levi's ASM list. If SWAS recurs, ethosuximide is a potential add-on (especially given its relative tolerability in pediatric cohorts). Worth reviewing full text before any ASM escalation discussion.

Epileptogenesis in DEE-SWAS: mechanisms and treatment implications

Mazhit A, et al.

dee-swasepileptogenesisthalamocorticaltreatmentreview2026

Findings

Review of epileptogenesis mechanisms in DEE-SWAS and implications for treatment sequencing. Cited twice in the 2026 Manus AI review (refs [7] and [42]). Covers thalamocortical circuit dysfunction, sleep-homeostasis disruption, and targeted treatment rationales.

Why it may matter for Levi

Mechanistic framing aligns with the existing corpus emphasis on thalamocortical circuit dysfunction and sleep-homeostasis disruption (Tononi-Cirelli SHY, Bolsterli slow-wave downscaling, Kramer/Chu spindle work). Reinforces existing differential weighting rather than adding new theory.

Sleep, epilepsy, and the glymphatic system: AES 2026 presentation

Abdennadher M, et al.

sleepglymphaticepilepsyaes2026

Findings

AES 2026 review covering the bidirectional relationship between sleep, epilepsy, and glymphatic clearance. Frames sleep disruption in epilepsy as both a consequence and a contributor to pathophysiology, with potential glymphatic clearance implications.

Why it may matter for Levi

Novel framing not yet in corpus - glymphatic clearance during slow-wave sleep is disrupted in DEE-SWAS given the SWS pathology. Opens a mechanistic thread connecting Levi's SWAS-era regression to potential clearance-related consequences. Not immediately actionable but worth tracking.

State of the art management of children with intractable epilepsy and brain tumors

(2026 authors - full byline pending full-text access)

pediatric-epilepsybrain-tumorthalamic-tumordee-swasreview2026

Findings

Management of pediatric intractable epilepsy in context of brain tumors. Highlights that some thalamic tumors may manifest electrographically as DEE-SWAS, reinforcing the need for high-quality MRI and specialist neuroradiology review in DEE-SWAS workup.

Why it may matter for Levi

Levi has had MRI with no tumor identified. This paper does not change management but reinforces the priority of a specialist pediatric-neuroradiology re-read looking for subtle thalamocortical lesions - already on the diagnostic priority list.

KCNA2-related spike-wave activation in sleep: genotype-phenotype correlations

Ma Y, et al.

kcna2dee-swasgenotype-phenotypegenetic-epilepsy2026

Findings

Genotype-phenotype study of KCNA2-related SWAS. Characterizes variant spectrum (gain-of-function vs loss-of-function), phenotypic range, treatment response patterns, and prognostic indicators.

Why it may matter for Levi

KCNA2 is on the DEE-SWAS genetic panel list. Levi's prior trio WES did not identify a KCNA2 variant, but the genotype-phenotype map here is useful for interpreting any ambiguous variants that might emerge on re-analysis or tissue-based sequencing.

CNKSR2 regulates anterior cingulate circuits for vocal communication

(2025 authors - full byline pending full-text access)

cnksr2anterior-cingulatevocal-communicationepilepsy-aphasiacircuit-mechanism2025

Findings

Mechanistic study of CNKSR2's role in anterior cingulate cortex circuits underlying vocal communication. Links CNKSR2 loss-of-function to specific circuit-level deficits relevant to the epilepsy-aphasia phenotype.

Why it may matter for Levi

Complements the Sun 2018 CNKSR2 case report already in the corpus. Adds circuit-level mechanism to a gene that sits on the differential (X-linked epilepsy-aphasia). Levi's germline workup was negative for CNKSR2 but mosaic possibility cannot be excluded without tissue sequencing.

SELECTS study: cognitive impairment biomarkers in DEE-SWAS

Yan Y, et al.

dee-swasbiomarkerscognitive-impairmentselectseeg2026

Findings

SELECTS study data on cognitive impairment biomarkers in DEE-SWAS. Identifies EEG (SWI, spindle density, HFO), clinical (age of onset, etiology), and potentially fluid-biomarker predictors of cognitive trajectory.

Why it may matter for Levi

Adds to the biomarker set Levi could be monitored on during the post-pulse electrographic-suppression window. Spindle density and SWI quantification are already on the diagnostic priority list; HFO analysis worth requesting on the next follow-up EEG if SELECTS criteria are adopted at Stanford/UCSF.

Neurodegeneration biomarkers in pediatric epilepsy: GFAP, NfL, and tau

Butera A, et al.

biomarkersgfapnfltauneurodegenerationpediatric-epilepsy2026

Findings

Study of fluid biomarkers (GFAP, NfL, tau) in pediatric epilepsy. Evaluates their utility for detecting ongoing neurodegeneration, astrocyte activation, and axonal injury in DEEs.

Why it may matter for Levi

GFAP as astrocyte-injury marker could provide a fluid biomarker complement to EEG for monitoring Levi during suppression. Worth discussing with Stanford/UCSF neuroimmunology team as adjunct to CSF workup already on the diagnostic list. Links to Shan 2026 astrocyte-dysfunction framing.

Childhood inflammation and adult brain structure: longitudinal findings

Merritt VC, et al.

neuroinflammationchildhood-inflammationbrain-structurelongitudinal2026

Findings

Longitudinal study linking childhood inflammatory exposure to adult brain structural differences. Supports the model that chronic childhood inflammation has measurable long-term structural consequences.

Why it may matter for Levi

Reinforces the existing neuroinflammation theory in the differential (secondary hypothesis). If Levi's Th1/Th17 signature persists untreated, the long-term structural consequences literature argues for active surveillance and, if indicated, immunomodulation. Supports existing CSF-cytokine/AE-panel/neopterin diagnostic priority.

Evolution of spike-wave activation in sleep: longitudinal EEG patterns

Iris Selfe, et al.

swaseegevolutionnatural-historylongitudinal2026

Findings

Longitudinal EEG study of how SWAS evolves over time in DEE-SWAS/EE-SWAS - typical age of onset, peak SWI, duration, resolution patterns, and relapse characteristics.

Why it may matter for Levi

Provides natural-history calibration for Levi's current post-pulse electrographic-suppression status. Useful for estimating relapse risk window and for timing the next quantitative SWI/HFO follow-up EEG.

SELECTS study: SWAS-to-EE-SWAS progression model

Hu Y, et al.

swasee-swasprogressionselectspredictors2026

Findings

SELECTS-cohort model of how SWAS progresses (or does not progress) to full EE-SWAS. Identifies clinical and electrographic predictors of conversion.

Why it may matter for Levi

Not directly applicable to Levi (already DEE-SWAS with pre-existing delay rather than EE-SWAS). But the progression model framework is useful for tracking how much additional regression Levi is likely to incur if SWAS recurs, and for weighting aggressive vs watchful-waiting escalation decisions.

Multicenter observational study comparing IV methylprednisolone pulse versus oral prednisolone plus clobazam in DEE-SWAS

van Arnhem M, et al.

dee-swasivmpmethylprednisolonepulseprednisoloneclobazammulticenterobservationaladverse-events2026

Findings

Multicenter observational study comparing IV methylprednisolone pulse versus oral prednisolone plus clobazam in DEE-SWAS. IV pulse carried 13 percent adverse-event rate vs 76 percent with oral prednisolone plus clobazam (p<0.001) with comparable electrographic efficacy. The strongest 2026 evidence for IV-pulse-first posture over extended oral steroid exposure.

Why it may matter for Levi

SINGLE MOST TREATMENT-ACTIONABLE paper in this ingestion pass. Levi received IV methylprednisolone pulse in March 2026 with near-total electrographic resolution - this paper validates that choice over the prolonged oral regimen with clobazam that is an alternative standard. Reinforces IV-pulse-first posture if SWAS recurs and Levi needs a second course. Does not change treatment rank, but strengthens evidentiary basis for top-ranked treatment choice.

Stiripentol in developmental and epileptic encephalopathies

Wheless JW, et al.

stiripentoldeesasmdravetreview2026

Findings

Review of stiripentol use in DEEs beyond its primary Dravet indication. Covers off-label DEE-SWAS experience, response rates, and tolerability.

Why it may matter for Levi

Stiripentol is not on Levi's current ASM list. In refractory DEE-SWAS it is a potential add-on, particularly if clobazam is co-administered (stiripentol increases clobazam levels). Worth flagging as a downstream option if initial escalation paths underperform.

Phase-targeted auditory stimulation for closed-loop sleep modulation in children

Wong SY, et al.

ptasclosed-loopsleep-modulationslow-wavepediatric2026

Findings

Phase-targeted auditory stimulation (PTAS) study applying closed-loop slow-wave enhancement in children. Shows feasibility and cognitive/sleep-quality signals in pediatric populations.

Why it may matter for Levi

Novel non-pharmacologic option for slow-wave sleep modulation - directly relevant to the Tononi-Cirelli sleep-homeostasis framework already in the corpus. Not yet clinically available for DEE-SWAS but worth tracking as an emerging modality. Adds to the neuromodulation options tier below rapalogs/IVIG/KD.

Thalamic neuromodulation for epilepsy

Gonzalez-Martinez JA, et al.

thalamicneuromodulationdbsepilepsyreview2026

Findings

Review of thalamic neuromodulation (DBS centromedian/anterior nucleus, RNS) for epilepsy. Covers indications, targeting strategies, outcomes, and emerging DEE applications.

Why it may matter for Levi

Thalamic DBS is a downstream neuromodulation option if Levi's DEE-SWAS becomes refractory to pharmacotherapy. Not near-term actionable but positions Levi's care pathway within the full treatment tier. Links to the Sanchez Fernandez 2012 and Van den Munckhof 2020 thalamic-injury literature already in the corpus.

Responsive neurostimulation in pediatric drug-resistant epilepsy

Geffrey AL, et al.

rnsneuromodulationpediatricdrug-resistant-epilepsy2026

Findings

Pediatric RNS experience and outcomes in drug-resistant epilepsy. Reviews indications, technical considerations, safety, and efficacy data in children.

Why it may matter for Levi

RNS is a potential late-stage option if Levi's epilepsy becomes focal-identifiable and drug-resistant after exhaustion of pharmacotherapy and other neuromodulation. Not near-term but defines the far end of the treatment-tier ladder.

Transcutaneous vagus nerve stimulation in EE-SWAS: prospective study

Gong P, et al.

tvnsvagus-nerve-stimulationee-swasnon-invasive-neuromodulationprospective2026

Findings

Prospective study of transcutaneous vagus nerve stimulation (tVNS) in EE-SWAS. Reports electrographic (SWI) and cognitive response data.

Why it may matter for Levi

tVNS is a non-invasive neuromodulation option with a meaningfully lower risk profile than implanted VNS or RNS. Worth tracking as an emerging option for Levi if SWAS recurs and standard escalation underperforms - potentially additive to pharmacotherapy rather than replacement.

Ketogenic diet therapy for pediatric epilepsy: Lancet Neurology update

Figueroa I, et al.

ketogenic-dietpediatric-epilepsybhblancet-neurologyreview2026

Findings

Lancet Neurology 2026 update on ketogenic diet therapy in pediatric epilepsy. Reviews mechanisms (including BHB-mediated E/I modulation), indications, response rates across DEE subtypes, and practical implementation.

Why it may matter for Levi

Ketogenic diet is in Levi's treatments workspace as a mid-tier option. This 2026 update strengthens the evidence base but does not change rank. Useful as a current synthesis reference if KD discussion becomes active.

Pediatric epilepsy treatment: 2026 review

Li X, et al.

pediatric-epilepsytreatmentreview2026

Findings

Broad 2026 review of pediatric epilepsy treatment covering ASMs, dietary therapy, immunotherapy, surgery, and neuromodulation. Consolidates current standard-of-care across pediatric epilepsy syndromes.

Why it may matter for Levi

Useful as a reference-level update but does not add specific Levi-relevant claims beyond what is already in the corpus. Low-urgency full-text review.

Quality of life in children with DEE-SWAS

Sahu JK, et al.

dee-swasquality-of-lifepediatricoutcomes2026

Findings

Quality-of-life assessment in children with DEE-SWAS across cognitive, behavioral, educational, and family-functioning domains.

Why it may matter for Levi

Supports framing Levi's care around QoL outcomes rather than only seizure freedom. Reinforces Zaldumbide-Alcocer 2024 and Tapia 2024 rehabilitation emphasis already in the corpus.

Caregiver quality of life in developmental and epileptic encephalopathies

Ludwig NG, et al.

caregiverquality-of-lifedeesfamily-burden2026

Findings

Assessment of caregiver quality of life in DEE populations. Identifies specific burden domains and factors predicting caregiver wellbeing.

Why it may matter for Levi

Directly relevant to Jake and Miki's sustained caregiving. Validates that caregiver QoL is a measurable clinical outcome, not a side concern. Supports explicit conversations about caregiver-directed support in Levi's care plan.

Autism-associated mutations converge on shared molecular pathways

Gordon A, et al.

autismshared-pathwaysconvergencemtorchromatinsynapticnature2026

Findings

Nature 2026 paper demonstrating convergence of diverse autism-associated mutations on shared molecular pathways - synaptic, chromatin regulation, and mTOR signaling. Cited twice in the 2026 Manus AI review (refs [30] and [38]). Strong support for mechanism-first rather than gene-first therapeutic strategies.

Why it may matter for Levi

Supports the shared-pathway framing that underlies Levi's differential structure (PI3K-AKT-mTOR, chromatinopathy, neuroinflammation all as convergent paths to overlapping phenotypes). Reinforces the case that identifying the specific convergent pathway for Levi matters more than identifying a specific gene - which directly argues for mechanism-targeted therapy (e.g., rapalog if mTOR pathway, HDAC inhibitor if chromatin, immunomodulation if neuroinflammation).

Expanding the genetic landscape of developmental and epileptic encephalopathies

Specchio N, et al.

deesgenetic-landscapemosaicismgene-specific-therapylancetreview

Findings

Lancet review of the expanding genetic landscape in DEEs. Covers gene discovery rates, emerging mosaic detection methods, and therapeutic implications (gene-specific therapies where available).

Why it may matter for Levi

Supports the rationale for re-analysis / tissue-based sequencing in Levi given his three negative germline workups - the genetic landscape has moved since his last analysis. Reinforces existing top diagnostic priority (mosaic-sensitive tissue-based PROS panel). Companion to the Freibauer 2023 and Mirzaa 2014 records already in the corpus.

Epilepsy in PTEN hamartoma tumor syndrome: cohort study

Jonker-Schieving CM, et al.

ptenphtsepilepsycohortmacrocephaly2026

Findings

Cohort study of epilepsy in PHTS. Characterizes phenotypic spectrum, MRI features, seizure types, treatment response, and the overlap with macrocephaly and ASD.

Why it may matter for Levi

Directly relevant to Levi's macrocephaly + DD/ASD + epilepsy phenotype. Complements Li 2024 PTEN pediatric cohort already in the corpus. PTEN variant remains a plausible candidate for mosaic reanalysis. Strengthens the argument for tissue-based PTEN sequencing.

mTOR inhibitors in tuberous sclerosis complex: meta-analysis

Ding Y, et al.

mtor-inhibitoreverolimussirolimustscmeta-analysisrapalog2026

Findings

Meta-analysis of mTOR inhibitor (everolimus, sirolimus) efficacy in TSC. Quantifies seizure reduction, SEGA volume reduction, skin lesion response, and adverse event profile.

Why it may matter for Levi

Template for what mTOR inhibitor therapy might look like if Levi is confirmed to have a mosaic PI3K-AKT-mTOR variant. The quantified efficacy data here are the evidentiary basis for advocating rapalog therapy in a confirmed mTORopathy context. Strengthens - without changing - the existing differential ranking.

Drug repurposing for PTEN-related disorders

Fieblinger T, et al.

ptendrug-repurposingmtoriscience2026

Findings

iScience 2026 drug-repurposing study for PTEN-related disorders. Identifies approved compounds with mechanism-relevant activity that could be considered for off-label or trial-based use in PTEN hamartoma syndromes.

Why it may matter for Levi

If Levi is confirmed to have a PTEN variant (germline or mosaic), this paper expands the therapeutic options beyond rapalogs into potentially-accessible repurposed drugs. Strengthens the general argument that a confirmed PTEN diagnosis opens meaningful therapeutic doors. Not actionable without a confirmed diagnosis.

STRADA mutations in megalencephaly: stem cell models

Pan Y, et al.

stradamegalencephalymtorlkb1ipsc2026

Findings

Stem Cell Reports 2026 study using patient-derived iPSC models to interrogate STRADA mutations in megalencephaly. Maps molecular consequences through the LKB1-mTOR axis.

Why it may matter for Levi

STRADA is a less-common mTORopathy gene. Not currently on Levi's differential top-tier but supports the broader case that multiple less-common genes converge on the PI3K-AKT-mTOR axis - reinforcing the case for a mosaic-sensitive PROS panel rather than a single-gene test.

STRADA loss of function disrupts cortical interneuron development

Parikh P, et al.

stradacortical-interneurone-i-balancebiorxivpreprint2026

Findings

Preprint (biorxiv 2026) showing STRADA loss-of-function disrupts cortical interneuron development, linking STRADA mutations to E/I imbalance mechanistically.

Why it may matter for Levi

Adds mechanistic detail to the STRADA-megalencephaly story from Pan 2026. Relevant via the E/I-imbalance mechanism shared with Zahra 2022 and Shan 2026 framings. Preprint status - worth tracking for peer-reviewed publication.

Autism spectrum disorder comorbid with epilepsy: Etiology, mechanism, and therapy

Shan M, et al.

autismepilepsycomorbiditye-i-balancegabaergicglutamatergicastrocytecbdreview2026

Findings

Neural Regeneration Research 2026 comprehensive review of ASD-epilepsy comorbidity. Covers genetic and environmental etiologies, E/I imbalance as core mechanism (GABAergic/glutamatergic), astrocyte dysfunction, maternal immune activation, and integrated etiology-mechanism-treatment clinical approach. Recommends integrating pharmacotherapy (with CBD showing promise), neurostimulation (DBS/VNS/TMS), dietary therapy, and immunotherapy.

Why it may matter for Levi

Consolidates multiple therapeutic axes under a single etiology-mechanism-treatment framework that fits Levi's multi-axis picture (DEE-SWAS + ASD + immune signal + overgrowth). Astrocyte-dysfunction framing is novel in this corpus; opens a mechanistic thread worth tracking if future imaging or biomarkers show astrocytic injury signatures (GFAP - per Butera 2026).

EPISTOP: secondary prevention of epilepsy in tuberous sclerosis complex

Specchio N, Jozwiak S, et al.

tscmtoropathysecondary-preventionvigabatrinpre-symptomatic-treatmentreview2025

Findings

EPISTOP secondary-prevention framework. EEG-guided pre-symptomatic vigabatrin started on the basis of pre-seizure EEG abnormalities substantially reduced clinical seizures, drug-resistant epilepsy, and infantile spasms in TSC infants. Establishes the conceptual model of EEG-guided pre-symptomatic intervention in a known mTORopathy.

Why it may matter for Levi

Levi is past the pre-symptomatic window - his epilepsy is established - so direct application is not possible. However, EPISTOP is a critical precedent for mTOR-pathway-targeted therapy in Levi's differential: if a mosaic PI3K-AKT-mTOR variant is confirmed, rapalogs have a proven disease-modifying track record in a related mTORopathy. Useful framing when discussing rapalog therapy with Stanford/UCSF - mechanism-based extension of an established secondary-prevention paradigm.

A tiered decisional framework for DEE-SWAS: from initial treatment to escalation

Perilli L, et al.

dee-swastreatment-algorithmescalation-frameworkdecisional-frameworkreview2026

Findings

Tiered decisional framework for DEE-SWAS treatment, with explicit escalation steps: first-line ASMs and SWAS recognition, IV pulse corticosteroids and benzodiazepines at SWI thresholds, surgery in lesional cases, neuromodulation/IVIG/ketogenic in non-lesional refractory cases, and long-term cognitive/rehabilitation monitoring. Stratified by etiology and age of onset.

Why it may matter for Levi

Levi has moved through the first two tiers (IV pulse methylprednisolone with near-total electrographic resolution). Framework reinforces that the next tier, if SWAS recurs, is etiology-stratified escalation (sulthiame, IVIG, benzodiazepine course, KD consideration) rather than defaulting to repeated pulses. Companion to the Rao 2025 Practical Neurology review already in the corpus.

EMA 2026 guidelines: clinical investigation of medicinal products in the treatment of epileptic disorders (update)

European Medicines Agency

emaregulatoryclinical-trialsepilepsy-guidelinesdees2026

Findings

EMA 2026 updated clinical trial design guidelines for investigational antiepileptic medicinal products. Includes specific considerations for pediatric DEE populations with small patient numbers, biomarker endpoints (EEG/SWI) alongside seizure frequency, adaptive trial design, and basket trials across mechanistically related DEEs.

Why it may matter for Levi

Regulatory backdrop against which emerging therapies (rapalogs, fenfluramine for DEE-SWAS, CBD, stiripentol) will move from investigational to standard. Supports advocacy framing: EU regulators have formally acknowledged pediatric DEE trial design needs adaptation. Worth revisiting when considering international trial enrollment if a mosaic diagnosis opens a targeted-therapy path.

Post-Batch Synthesis - April 16, 2026

Post-Batch Synthesis (2026-04-16)

This memo consolidates the corpus as of April 16, 2026 and establishes the evidentiary baseline for the first population of content/differential/etiologies.yaml, content/diagnostics/diagnostics.yaml, content/treatments/treatments.yaml, content/people/people.yaml, and the refreshed content/case-overview.md. Previously these synthesis surfaces were empty placeholders. All reasoning below is grounded in files already in the repo.

Clinical phenotype in one paragraph

Levi is a 5.5 y/o previously normally developing boy with symmetric, proportional overgrowth since ~12 months (height/weight/head circumference at ~99th percentile, no dysmorphism, no neurocutaneous stigmata), slow developmental regression from ~2.5 years (loss of language and social engagement culminating in complete nonverbal regression around age 5), a January 16, 2026 episode with WBC 24.2 with left shift (no documented source identified in repo), and a March 10, 2026 overnight EEG establishing DEE-SWAS (formerly CSWS/ESES) with very high sleep and wake spike-wave index. He had dramatic clinical and electrographic response to a 3-day IV methylprednisolone pulse (March 23-25, 2026 at 700 mg/day prednisolone), with near-resolution of spike-wave burden by April 6-7, 2026. Brain MRI on April 7, 2026 showed only nonspecific patchy periventricular deep white matter FLAIR signal, R>L. Lumbar puncture same day (traumatic tap) had no true pleocytosis, normal CSF chemistries, negative OCBs, but CSF autoimmune panel and CSF cytokines were not sent. Serum on April 6 showed an abnormal Th1/Th17-weighted cytokine signature (sIL-2R 1031, IFN-γ 12.7, TNF-α 13.3, IL-17 1.8, IL-13 4.0) with normal WBC at that point. Baseline QTc is unknown — the 2024 Stanford EKGs (460 → 452 ms) were captured while Levi was not cooperative and should be treated as uninterpretable until a cooperative repeat EKG is obtained. (2026-04-17 correction.) Persistent mild iron deficiency, persistent mild low CO2 (normal anion gap), borderline low IgG 518. May 2025 Tiny Health microbiome was high-diversity, no pathogens, histamine-producers 0%, with the only notable finding being Akkermansia muciniphila overabundance (5.3%).

What we know firmly

  • DEE-SWAS diagnosis is established (March 10, 2026 overnight EEG; case overview; timeline). Severe sleep spike-wave activation; treatment-responsive to IV steroids within two weeks.
  • Not classical antibody-positive autoimmune encephalitis (comprehensive Mayo AE serum panel March 23, 2026 negative: NMDA-R, GAD-65, AMPA-R, GABA-B-R, LGI1, CASPR2, MOG, DPPX, mGluR1, GFAP, Neurochondrin, NMO/AQP-4, PCA-Tr, ANNA-1). Note caveats: (1) serum only, CSF more sensitive for NMDA-R, (2) sample drawn the same day steroids started.
  • Not classical inborn error of metabolism (January 16, 2026 metabolic panel: plasma acylcarnitines normal, plasma amino acids normal, MMA normal, homocysteine normal, creatine disorder panel normal).
  • Not primary mitochondrial disease (serum lactate 0.9 low-normal; CSF lactate 1 low-normal; CSF pyruvate normal).
  • Not urea cycle disorder (ammonia 29 normal).
  • Not Hashimoto encephalopathy / SREAT (thyroglobulin Ab <2.00, TPO Ab <63, both negative).
  • Not MS-like CNS humoral autoimmunity (CSF and paired serum oligoclonal bands both 0).
  • Not Fragile X (FMR1 33 CGG repeats).
  • No overt lead toxicity at 2024 baseline.
  • No acute CNS infection or classical meningoencephalitis on April 7, 2026 (CSF TNC 2, glucose 59, protein 23; traumatic tap caveat).
  • No gross dysbiosis, overt enteric pathogen, or histamine-producer overgrowth in May 2025 (Tiny Health: no C. difficile, H. pylori, Klebsiella, Salmonella, Pseudomonas, parasites, or fungi; histamine-producing species 0%; strong Bifidobacterium retention).

What is abnormal and demands explanation

  1. Symmetric proportional overgrowth since ~12 months at 99th %ile across height, weight, head circumference, no dysmorphism, no skin findings. This is the phenotype with the highest prior probability of pointing at a specific genetic syndrome cluster. Candidates include PI3K-AKT-mTOR axis disorders (PTEN, PIK3CA, AKT, mTOR, TSC1/2), Sotos/NSD1, Weaver/EZH2, BWS/imprinting, CLOVES-spectrum somatic PIK3CA, and other overgrowth syndromes. None have been excluded in the current corpus because no chromosomal microarray, no whole-exome sequencing, no trio WES, and no PTEN/mTOR-pathway-specific testing are yet in the vault (the genetics/ folder is empty). Fragile X negative only excludes Fragile X.
  2. DEE-SWAS with near-total steroid response. Corticosteroid responsiveness is well-described in idiopathic DEE-SWAS and in many secondary DEE-SWAS etiologies; it is not specific to autoimmune mechanism. It is consistent with a broad inflammatory-contribution hypothesis, a GRIN/GABA/mTOR-pathway hypothesis, and with Landau-Kleffner-like variants, among others.
  3. Serum Th1/Th17 cytokine signature (elevated sIL-2R, IFN-γ, TNF-α, IL-17, plus IL-13) drawn one day before the MRI and one day before the LP, without a concurrent infection, and with normal WBC. This pattern is nonspecific but compatible with: (a) CNS-adjacent or systemic autoinflammation, (b) pre-analytic or assay-specific artifact, (c) residual from the January 16, 2026 event, (d) HLH-adjacent / MAS-adjacent immune activation, or (e) an unmeasured gut-or-tissue-compartmentalized inflammatory process. This signal is the single most significant new inflammatory biomarker in the corpus and was not followed up by CSF cytokines on the same-day LP — that is the single biggest avoidable gap.
  4. Nonspecific patchy periventricular deep white matter FLAIR signal, R>L on MRI April 7, 2026. This is the only structural finding in the repo. It is too nonspecific to anchor a specific etiology but is compatible with post-encephalopathic change, a microangiopathic process, a leukodystrophy-adjacent pattern, hypoxic-ischemic residua, mTOR-related white matter changes, or simply delayed or disrupted myelination.
  5. January 16, 2026 leukocytosis (WBC 24.2 with neutrophilia and immature granulocytes) that fully resolved by April 6. No source identified in the repo. Coincided with (or preceded by weeks) the acute escalation of regression that culminated in the DEE-SWAS diagnosis. Worth formally investigating whether an infectious or inflammatory trigger seeded or accelerated the DEE-SWAS.
  6. Uninterpretable 2024 Stanford EKGs (automated reads of QTc 460 → 452 ms) — both captures were acquired while Levi was not cooperative and should be treated as uninterpretable; baseline QTc is currently unknown. Pediatric pharmacology constraint (needs cooperative repeat EKG before QT-prolonging medications), not an etiologic clue. (2026-04-17 correction — earlier draft framed this as a persistent borderline QTc signal; retired.)
  7. Persistent iron deficiency (iron 16 at Jan 16, 2026; ferritin 27 at Apr 7, 2026; transferrin sat 13%). Amplifier of seizures, attention, sleep — not a root cause but a fixable modifier.
  8. Persistent mild low CO2 with normal anion gap across 2024-2026. Could be RTA, chronic hyperventilation, diet, or artifact; warrants its own minor workup.
  9. Borderline low IgG 518 (reference 532-1340), with normal IgM, IgA, IgE. Marginal humoral finding that should be repeated with subclasses.
  10. Akkermansia muciniphila overabundance 5.3% at May 2025 (reference 0.7-3.25%). Single abnormal genus. In adults generally beneficial; in pediatric literature has been linked to mucin-layer over-consumption and eczema. Etiologic relevance unclear; not a leading lead but worth tracking if gut-brain hypothesis is pursued.

Synthesized etiologic framework

The phenotype (overgrowth since infancy + prolonged slow regression + DEE-SWAS + steroid-responsive + nonspecific white-matter MRI + Th1/Th17 serum cytokine signature + no classical metabolic/infectious/MS-like/autoimmune-Ab-positive etiology identified) is best thought of as three overlapping hypothesis families that are not mutually exclusive:

Family A — Overgrowth-linked genetic/epigenetic syndrome with secondary epileptogenesis

Hypothesis: a germline or mosaic variant in the PI3K-AKT-mTOR axis (PTEN hamartoma tumor syndrome, PIK3CA-related, AKT, mTOR, TSC1/2) or an epigenetic / overgrowth syndrome (Sotos/NSD1, Weaver/EZH2, BWS/imprinting) that produces (a) proportional overgrowth from infancy and (b) subsequent epileptic encephalopathy, with or without autistic regression.

Why it fits:

  • Symmetric proportional overgrowth from ~12 months at 99th %ile across all three axes without dysmorphism is a very high prior for this cluster, and several syndromes in this family have well-described associations with autism, regression, epilepsy, and white matter abnormalities.
  • PTEN, Sotos, and mTOR-pathway disorders have all been associated with both macrocephaly/overgrowth and autism-spectrum regression.
  • mTOR-pathway dysregulation is associated with epileptic encephalopathies including DEE.

Why it might not fit:

  • No skin findings, no tubers, no café-au-lait macules documented - argues somewhat against TSC and NF1.
  • MRI is nonspecific - no cortical tubers, no focal cortical dysplasia, no hamartomas described in the current repo summary (but the full radiology report is not yet extracted).
  • The Th1/Th17 signature is not a classical feature of these syndromes.

Strongest testing gap:

  • No WES/trio WES, no chromosomal microarray, no PTEN-specific sequencing, no mTOR-pathway panel, no methylation analysis in the vault. This is the single most important testing gap in Levi's workup.

Family B — Smoldering inflammatory / autoinflammatory encephalopathy not captured by the classical AE antibody framework

Hypothesis: a CSF-compartmentalized or cell-mediated (Th1/Th17-biased) inflammatory process drives or amplifies the DEE-SWAS, without classical surface-antigen antibodies being detectable in serum.

Why it fits:

  • Serum Th1/Th17 cytokine signature (sIL-2R, IFN-γ, TNF-α, IL-17 all elevated together, with IL-13) at a timepoint without infection.
  • Dramatic steroid responsiveness with both clinical and electrographic improvement within two weeks.
  • January 2026 leukocytosis with left shift that preceded (or coincided with) the worst period of regression.
  • Absence of classical AE antibodies does not exclude cell-mediated or seronegative CNS autoimmunity.
  • Some DEE-SWAS cases respond to IVIG and some to sustained immunomodulation, consistent with this family.

Why it might not fit:

  • CSF showed no pleocytosis, normal protein, negative OCBs. This argues against overt CSF immune cell trafficking.
  • hsCRP undetectable on April 6 argues against systemic active inflammation at that snapshot.
  • The Th1/Th17 pattern could reflect residual from the January 16 event rather than an active CNS process.

Strongest testing gap:

  • CSF cytokines were not sent on April 7 — this is the single most decision-relevant missing test in the inflammatory hypothesis.
  • CSF autoimmune encephalitis panel was not sent.
  • No CSF neopterin, 5-HIAA/HVA, CSF folate.
  • IL-6 / IL-8 / IL-10 not in the serum cytokine panel that was sent.

Family C — Mixed / multifactorial / idiopathic DEE-SWAS

Hypothesis: Levi has an idiopathic DEE-SWAS of unknown specific cause, potentially potentiated by iron deficiency, micronutrient status, borderline humoral immunity, and an as-yet-unexplained overgrowth phenotype, with no single unifying root cause.

Why it fits:

  • Many DEE-SWAS cases never get a unifying etiology.
  • Multiple metabolic, immunologic, and infectious categories are already convincingly excluded.
  • Treatment response to steroids is dramatic even in idiopathic DEE-SWAS.

Why it might not fit:

  • The overgrowth phenotype is too distinctive to leave on the table without a focused genetic workup.
  • The Th1/Th17 serum cytokine signature is too suggestive to dismiss.

Strongest testing gap:

  • There is no way to confidently conclude "idiopathic" until (a) the genetic workup has been done and (b) CSF cytokines have been measured. Calling it idiopathic before those is premature.

Key unknowns that would meaningfully reshape the differential

  1. Full brain MRI report (sequences, detailed description of white matter pattern, whether there is any hamartoma, subependymal nodule, tuber, or perivascular finding) — we only have the case-overview single-line summary right now.
  2. WES / trio WES result or at minimum a chromosomal microarray.
  3. CSF cytokines, CSF AE panel, CSF neopterin, CSF neurotransmitter metabolites, CSF folate.
  4. A repeat serum cytokine panel in the steroid-off state to distinguish residual January 2026 effect from an active process.
  5. EEG quantitative spike-wave index at each timepoint (we currently only have qualitative "very high" and "near resolution").
  6. Whether there was an identified infectious source for the January 16, 2026 leukocytosis.
  7. Whether Levi has had any imaging of abdomen, echocardiogram, skin exam with Wood's lamp, or ophthalmologic exam for hamartomas.

Lower-priority / near-ruled-out

  • Classical inborn errors of metabolism (essentially ruled out by Jan 16, 2026 panel).
  • Classical antibody-positive autoimmune encephalitis (serum panel negative; caveat CSF not tested).
  • Fragile X (ruled out).
  • Primary mitochondrial disease with systemic lactic acidosis (serum 0.9, CSF 1.0).
  • Urea cycle disorder (ammonia normal).
  • Hashimoto encephalopathy (thyroid Abs negative).
  • MS-spectrum / classical demyelinating disease (OCB 0, CSF clean).
  • Overt gut dysbiosis or histamine-producer-driven phenotype (microbiome May 2025).
  • Lead toxicity at 2024 baseline.

Decisive next steps (ordered by information yield)

  1. Trio whole-exome sequencing + chromosomal microarray + methylation panel (overgrowth/imprinting). Single highest-yield action.
  2. Targeted PTEN / PI3K-AKT-mTOR pathway sequencing if WES is delayed or inconclusive.
  3. Full brain MRI radiology report extraction into the vault and review with a neuroradiologist familiar with mTORopathies.
  4. Repeat LP with CSF cytokines (Th1/Th17 panel), CSF AE panel, CSF neopterin, CSF neurotransmitter metabolites (HVA, 5-HIAA), CSF folate. Coordinate timing with steroid taper so results aren't confounded.
  5. Repeat serum cytokine panel off steroids to confirm / refute the Th1/Th17 signature.
  6. Repeat EEG in ~4-8 weeks with quantitative SWI to document whether spike-wave suppression is durable.
  7. IgG subclass panel + repeat total IgG given borderline 518.
  8. Iron repletion (oral iron, target ferritin >50 and transferrin sat >20%).
  9. Cardiology review before any new neuroactive / immunomodulatory drug with QT-prolonging potential.
  10. Formal review of the January 16, 2026 illness - was there a source identified? Is there a stored specimen or a record of any infectious testing?

Treatment-decision implications

  • Maintain current posture of spike-wave suppression while the etiologic workup proceeds. DEE-SWAS itself has a well-described relationship between sustained spike-wave suppression and preservation of cognitive gains; the longer SWI stays low the better.
  • Keep steroid-sparing immunomodulation on the table (IVIG, repeated IV methylprednisolone pulses, oral taper, or sulthiame / benzodiazepines per DEE-SWAS literature) contingent on the next EEG and the CSF workup.
  • Ketogenic diet and high-dose diazepam protocols are established DEE-SWAS second-line options and should be in the mental model even if not activated yet.
  • Avoid QT-prolonging agents (certain TCAs, some AEDs, some stimulants) without cardiology clearance.
  • Do not escalate to mTOR-pathway-directed therapy (sirolimus, everolimus) without genetic or pathway-specific evidence — the downside is significant and the evidence base needs to be pathway-specific.
  • Consider iron repletion aggressively. Low clinical risk, concrete upside for seizure threshold, attention, sleep.

People / organizations most worth engaging now

  • Stanford pediatric epileptology (Christopher Lee-Messer, MD, PhD) — already involved, ordered the AE panel.
  • Medical genetics (Jonathan Bernstein, MD, PhD at Stanford) — presumed lead for the genetic workup.
  • UCSF neurology team (Aylin Ulku and team) — ordered the cytokine panel and LP; best positioned to add the CSF follow-ups.
  • A pediatric neuroimmunologist — for the Th1/Th17 interpretation and decision about next immunomodulation.
  • A DEE-SWAS / ESES focused group — e.g., CSWS-focused clinicians at centers that run dedicated CSWS/ESES clinics.
  • An overgrowth-syndrome-focused geneticist (PTEN, Sotos, mTOR) — for the overgrowth/regression-with-overgrowth phenotype.
  • The lab director teams already named in content/providers/providers.yaml as logistical points of contact for assay add-ons and stored-specimen questions.

Things this memo is explicitly NOT saying

  • It is not saying Levi has mTOR-pathway disease. It is saying that mTOR-pathway disease has the highest prior probability among the genetic-overgrowth candidates and should be tested for, not assumed.
  • It is not saying Levi has autoimmune encephalitis. It is saying there is a non-trivial inflammatory signal that should be extended to CSF and followed longitudinally before being dismissed.
  • It is not saying any of this replaces direct clinical judgment by Levi's treating team.
  • It is a synthesis layer grounded in the current repo state and should be revisited after the next meaningful data arrives.
Literature Pass - April 16, 2026 - Source-Linked Evidence for Leading Hypotheses

Literature Pass (2026-04-16)

This memo is the external literature companion to content/research/notes/2026-04-16-batch-synthesis.md. The earlier memo and the first population of differential/etiologies.yaml, diagnostics/diagnostics.yaml, treatments/treatments.yaml, and people/people.yaml were grounded in the current repo state only — no external evidence was pulled. This memo closes that gap by providing source-linked evidence for each leading hypothesis and treatment claim so downstream files can cite primary references rather than circular internal notes.

The memo is organized by the claim it supports, not by paper. Each claim block lists the papers I actually read through Claude web search on 2026-04-16, what they say, how strong the evidence is, and how it moves Levi's differential / diagnostics / treatments.


Claim 1 — PI3K-AKT-mTOR axis disorders (PTEN, PIK3CA, AKT3, MTOR, TSC1/2, DEPDC5, NPRL2/3, STRADA) are a diagnostically important cause of combined macrocephaly, developmental delay, and treatable pediatric epilepsy, including focal epilepsies and DEE phenotypes

What the literature says

  • Yeung et al. 2017 (Molecular Autism) — Identification of PI3K-AKT-mTOR mutations in children with macrocephaly + developmental delay / autism: pathogenic or likely pathogenic variants in PTEN, PIK3CA, MTOR, and PPP2R5D were found in ~10 of a cohort of children selected for macrocephaly and DD/ASD. Affected children had megalencephaly on MRI and lower developmental quotient than the rest of the cohort. Two had somatic mosaic PIK3CA variants detectable in blood at low mosaicism. Molecular Autism 2017
  • Jansen et al. 2015 (Brain) — PI3K/AKT pathway mutations cause a spectrum from megalencephaly to focal cortical dysplasia, with somatic mosaicism explaining the focal-vs-hemispheric-vs-whole-brain gradient. Brain 2015 / PMC4614119
  • Mirzaa & Poduri 2014 — Brain overgrowth in RTK-PI3K-AKT signaling is a "mosaic of malformations" spectrum, with germline mutations tending toward whole-brain overgrowth and postzygotic somatic mutations tending toward hemimegalencephaly or FCD. PMC4268391
  • Li et al. 2024 (Pediatric Neurology) — Pediatric PTEN cohort (n=13): 100% macrocephaly, 92% developmental delay, 38% ASD, 15% epilepsy. Pooled across seven studies (665 pediatric PTEN patients, 26 with epilepsy), focal seizures were most common. Drug-resistant epilepsy was seen mainly in children with abnormal brain MRI. ScienceDirect
  • PHTS German pediatric guideline (Busch et al.) — comprehensive review of PTEN hamartoma tumor syndrome in childhood; cancer-surveillance implications if PTEN is confirmed. PMC8859017
  • GeneReviews: PIK3CA-Related Overgrowth Spectrum (PROS) — clinical practice guidelines (Douzgou et al. 2022); FDA-approved targeted therapy (alpelisib / Vijoice) exists; seizure types vary with tissue distribution of the mosaic variant. NCBI Bookshelf NBK153722
  • Lasser et al. 2024 (eLife) — mechanistically, PTEN loss hyperactivates both mTORC1 and mTORC2; rapamycin rescues epilepsy and mortality in mouse models of PTEN loss even after epilepsy is established, but for PTEN/PIK3CA/AKT disorders dual PI3K/mTOR inhibitors may be more effective than mTORC1-selective rapalogs. PMC10942640
  • Roy et al. 2015 (eLife) — PIK3CA-mutant mice have acutely treatable epilepsy; PI3K signaling is itself epileptogenic independent of dysplasia, and AKT inhibition acutely suppresses seizures. eLife 2015
  • Epilepsy in the mTORopathies (Brain Communications, 2021) — ≥16 distinct mTOR pathway genes produce epilepsy-plus-neurodevelopmental phenotypes; mTOR inhibitors (everolimus) already have labeled epilepsy indications in TSC. Brain Communications 2021
  • D'Gama et al. (medRxiv 2021) — ddPCR on brain tissue is required for detecting low-mosaicism somatic variants; peripheral blood often misses them. ~80% of mutated FCD type II cases have brain mosaic rates <5%. medRxiv 2021

Strength of evidence as applied to Levi

  • Moderate-to-high that PI3K-AKT-mTOR disorders are a plausible, testable, and potentially treatable explanation for symmetric overgrowth + developmental regression + epilepsy.
  • Limitation specific to Levi: overgrowth is symmetric and whole-body, not segmental, hemispheric, or asymmetric. This is more consistent with germline (e.g., PTEN, or a germline PIK3CA variant consistent with MCAP-spectrum) than with post-zygotic somatic mosaic PIK3CA/AKT3/MTOR causing focal overgrowth. Blood-based WES/panel is appropriate as a first-line step; if negative, the literature supports not stopping there, because low-mosaicism somatic variants in affected tissue (brain) can be missed by blood sequencing alone.
  • MRI caveat: Levi's MRI is reported as only mild nonspecific periventricular FLAIR change, not overt megalencephaly or FCD. The Yeung cohort noted that all children with identified PI3K-AKT-mTOR mutations had megalencephaly on MRI — so the MRI report should be re-reviewed by a pediatric neuroradiologist for subtle megalencephaly, cortical dysplasia, or a "bottom of sulcus" dysplasia before PI3K-AKT-mTOR disorders are de-emphasized.

Impact on Levi's workspace

  • Differential: keep overgrowth-pi3k-akt-mtor-axis as a leading plausible theory; add explicit key_references to Yeung 2017, Li 2024, Roy 2015, PIK3CA GeneReviews, and Lasser 2024.
  • Diagnostics: strengthen trio-wes-cma-methylation and full-mri-report-neuroradiology-rereview (the latter gains specific weight from the Yeung cohort's 9/9 megalencephaly finding).
  • Treatments: keep mtor-directed-therapy-conditional explicitly gated on molecular confirmation because (a) empiric rapalogs in non-mTORopathy epilepsy are not supported by this literature, and (b) for PTEN/PIK3CA/AKT specifically, dual PI3K/mTOR inhibitors (or AKT inhibitors) may actually outperform rapalogs — so the specific drug choice will depend on which gene is hit.

Claim 2 — Sotos (NSD1) and Weaver (EZH2) are the classical epigenetic overgrowth syndromes with a meaningful but not universal epilepsy phenotype, and their developmental course is typically delay rather than frank regression

What the literature says

  • Fortin et al. 2021 (Epilepsia Open) — Sotos syndrome seizure phenotyping in 49 patients, 15/20 with NSD1 pathogenic variants: seizures present in a large subset; staring spells were the most common semiology (67%), followed by febrile seizures and bilateral tonic-clonic (each 51%). Most patients (67%) had multiple seizure types; 18% had drug-resistant epilepsy; median onset age ranged from 3 months to 12 years. PMC8166795
  • Sotos Syndrome — GeneReviews (Tatton-Brown et al.) — ~25% of Sotos patients develop non-febrile seizures. NCBI NBK1479
  • Sotos imaging review (AJNR 2024) — malformations of cortical development, hippocampal incomplete rotation, corpus callosum and midline anomalies reported in a subset; these findings are subtle and can be missed on routine reports. AJNR 2024
  • Tatton-Brown et al. 2013 (Am J Med Genet A) — Weaver syndrome (EZH2) clinical phenotype: >90% tall stature, ~80% intellectual disability (typically mild), epilepsy reported in a subset but less consistently than in Sotos. Significant phenotypic overlap with Sotos. PubMed 24214728
  • EZH2-Related Overgrowth — GeneReviews — spectrum from classic Weaver syndrome to isolated tall stature; management is supportive. NCBI NBK148820
  • 2025 Weaver case report (PMC12419298) — novel SANT-domain EZH2 variant with corpus callosum dysgenesis, bifrontal hypoplasia, and severe phenotype; widens the phenotypic spectrum to include complex brain malformations. PMC12419298

Strength of evidence as applied to Levi

  • Moderate. Both syndromes are testable through clinically available methylation/panel testing, and both can produce the combination of overgrowth + developmental delay/disability + some seizure activity. Neither is a perfect Levi fit: classic Sotos has a distinctive dolichocephalic/facial gestalt that Levi is not documented to have, and classic Weaver has characteristic camptodactyly and skin texture findings that are not documented in the corpus. However, the phenotypic spectrum for both is wider than the classic descriptions (esp. Weaver with recent cases showing atypical brain malformations), so they remain important differential members and should be formally tested.
  • Regression caveat: Sotos is classically described as nonprogressive — frank regression of the kind Levi showed (loss of established language, social disengagement) is atypical. This weakens but does not eliminate the hypothesis. DEE-SWAS superimposed on an underlying overgrowth syndrome is a reasonable combined model.

Impact on Levi's workspace

  • Differential: keep overgrowth-sotos-weaver-epigenetic at "plausible" but do not elevate above PI3K-AKT-mTOR absent additional dysmorphism evidence; add references; note the classic-phenotype caveat explicitly in evidence_against.
  • Diagnostics: the proper molecular test here is methylation array + epigenetic signature (EpiSign or similar) + NSD1/EZH2 sequencing — methylation-class testing catches many Mendelian overgrowth syndromes including Sotos and Weaver at once and is often more efficient than stepwise gene-by-gene testing. This should be explicitly noted in the trio-wes-cma-methylation item.

Claim 3 — Neuroinflammation, including IL-1β / TNF-α / Th1-axis cytokine elevation, is mechanistically implicated in DEE-SWAS / CSWS / ESES, and CSF cytokine measurement is informative in seizure encephalopathies

What the literature says

  • 2025 CSF cytokine study in ESES (PubMed 40323354) — CSF levels of IL-1β, TNF-α, IL-1α, and caspase-1 are significantly elevated in ESES vs non-ESES controls. IL-1β correlated with caspase-1 and TNF-α. Authors conclude that inflammasome activation and IL-1/TNF axis are tightly linked to ESES pathogenesis. PubMed 40323354
  • van den Munckhof et al. 2016 (Epilepsia) — serum inflammatory mediators correlate with ESES disease activity, supporting the inflammatory-drive model in children where CSF was not available. (cited in the 2025 paper above)
  • Kothur et al. 2019 (Epilepsia) — FIRES / febrile refractory status: Th1-associated cytokines and chemokines (TNF-α, CXCL9, CXCL10, CXCL11) plus IL-6, CCL2, CCL19 are prominently elevated in CSF in FIRES; chronic epilepsy shows much milder elevations; profile is etiology-dependent, not just "any seizure causes cytokine elevation." PubMed 31283843
  • CSF cytokines in severe viral encephalitis and refractory status — cytokine profiles help distinguish primary viral encephalitis from immune-mediated parainfectious syndromes. PMC11847810
  • Th17 in neurological disorders — Th17 cells produce IL-17A, IL-21, IL-23, IL-6, and IFN-γ, with known roles in multiple sclerosis, neuromyelitis optica, and other CNS autoimmune syndromes; IFN-γ and Th1/Th17 cell ratios discriminate MS phenotypes. Frontiers in Immunology 2022 ; Frontiers 2025
  • Glucocorticoids and IL-2 / Th17 — glucocorticoids can paradoxically promote Th17 differentiation by suppressing IL-2; this is relevant because Levi's serum cytokine signature was drawn one day before MRI and LP but conveniently also after the steroid course, raising the question of whether the observed serum pattern reflects the underlying disease, the steroid effect, or both. JACI 2018

Strength of evidence as applied to Levi

  • Moderate. The DEE-SWAS / CSF cytokine evidence is real and recent but comes from small cohorts and is not yet established as routine clinical practice. It is strong enough to say: had CSF cytokines been sent on April 7, 2026, they would have been meaningfully informative. It is not strong enough to say the serum Th1/Th17 pattern alone proves CNS neuroinflammation.
  • Key limitation of Levi's April 6 serum result: the sample was drawn after most of the methylprednisolone pulse was already given (pulse 3/23-3/25). Steroids both suppress some cytokines and can skew toward Th17. So the serum panel is not a clean pre-treatment measurement of the underlying inflammatory state. A repeat serum cytokine panel at least 8 weeks after steroid washout, ideally paired with a same-day non-traumatic LP for CSF cytokines/neopterin/AE panel, would be dramatically more informative.

Impact on Levi's workspace

  • Differential: strengthen seronegative-cell-mediated-neuroinflammation with these references. Do not increase its likelihood %-ile on the strength of a single steroid-contaminated serum panel.
  • Diagnostics: repeat-lp-csf-cytokines-ae-neopterin gains direct support (explicitly cite the 2025 CSF study); rank remains high. repeat-serum-cytokine-off-steroids gains direct support because the glucocorticoid-Th17 interaction literature says the post-steroid serum profile is confounded.
  • Treatments: steroid-sparing immunomodulation remains reasonable only if CSF / repeat-serum evidence confirms ongoing inflammation; if it doesn't, the hypothesis should lose weight.

Claim 4 — DEE-SWAS / CSWS / ESES treatment evidence supports corticosteroids and high-dose benzodiazepines as the two best-supported first-line options, with meaningful second-line roles for sulthiame, IVIG, levetiracetam, ketogenic diet, and surgical resection when a focal lesion exists

What the literature says

  • van den Munckhof et al. meta-analysis (576 ESES cases) — cognition or EEG improvement rates: surgery ~90%, steroids ~81%, benzodiazepines ~68%, standard ASMs ~49%. Sulthiame ~53%, levetiracetam ~54%. Seizure journal review 2017
  • RESCUE ESES RCT (van den Munckhof et al. 2024, Lancet Neurol) — steroids vs clobazam head-to-head; underpowered due to poor enrollment, but showed ~25% IQ improvement in the steroid arm that was not seen in the clobazam arm. Side-effect burden similar. ScienceDirect 2024
  • Buzatu et al. 2009 (Epilepsia) — retrospective 44-child cohort: corticosteroids produced long-lasting response in ~45% after initial trial. Higher baseline IQ/DQ and shorter CSWS duration before treatment were significantly associated with positive response. Treatment regimen was hydrocortisone 5 mg/kg/day with 21-month slow taper to minimize relapse. Wiley Epilepsia 2009
  • European steroid survey 2025 — practice varies widely; many regimens in use; no standardized protocol exists; all major European DEE-SWAS centers use steroids as a first-line option. PMC12039249
  • Current and Future Treatment Strategies (2025 review) — paradigm shift toward etiology-driven precision-medicine rather than syndrome-driven treatment; reports <33% of patients without cognitive sequelae under classic syndrome-driven approach. ScienceDirect 2025
  • IVIG observational (Saudi multicenter) — IVIG alone significantly improved 6-month cognitive scores vs steroid alone; no additional effect when combined. Suggests IVIG and steroids have distinct mechanisms. Seizure journal 2023
  • Sulthiame — consistently around 50% efficacy in observational data; used widely in Europe, less available in US. Kotagal 2017, PMC5716110
  • Avoid oxcarbazepine and carbamazepine — can worsen spike-wave index in DEE-SWAS. Practical Neurology DEE-SWAS review

Strength of evidence as applied to Levi

  • Moderate overall, high for "use steroids first-line," moderate for "steroids + benzodiazepines combination is better than either alone," low for exact relapse rates because most data come from retrospective cohorts.
  • Levi has already had a dramatic electrographic and clinical response to a short IV pulse. The literature (Buzatu) supports transitioning to a slower long taper (e.g., oral hydrocortisone with a multi-month taper) rather than a short course only to reduce relapse risk, provided side-effect profile allows. The higher-baseline-IQ-and-shorter-CSWS-duration predictor is relevant: Levi's regression had been long and deep by the time DEE-SWAS was diagnosed, which modestly worsens prognosis under this model, but the acute response he had is still a positive prognostic sign.

Impact on Levi's workspace

  • Treatments: revise maintain-spike-wave-suppression and add a specific item for steroid taper strategy with Buzatu-style long oral taper if a sustained taper is clinically appropriate. Add direct references. Explicitly note the RESCUE ESES and Buzatu results. Add avoid-oxcarbazepine-carbamazepine as an explicit cautionary item.
  • Diagnostics: repeat-eeg-quantitative-swi is directly supported as the natural surrogate for treatment efficacy.
  • Differential: the fact that Levi responded to steroids is not diagnostic for autoimmune etiology — steroid response is observed across ESES etiologies including presumed structural, genetic, and idiopathic subgroups. Adjust seronegative-cell-mediated-neuroinflammation language accordingly.

Claim 5 — Pediatric seronegative autoimmune encephalitis has formal criteria (Cellucci 2020; Graus 2016) and a meaningfully high mimic rate; diagnosis should not rest on clinical suspicion alone

What the literature says

  • Cellucci et al. 2020 (Neurol Neuroimmunol Neuroinflam) — pediatric-specific clinical approach; three categories: possible AE, probable antibody-negative AE, definite antibody-positive AE. Uses EEG findings as altered-mental-status criterion; incorporates developmental criteria. PubMed 31953309
  • Graus et al. 2016 (Lancet Neurol) — original adult criteria; strict criteria for probable autoantibody-negative AE. Graus framework summarized in 2024 Lancet Neurol pitfalls review
  • Titulaer 2024 (Dev Med Child Neurol) — editorial / review on seronegative pediatric AE: emphasizes that the AE label is often applied loosely in pediatrics and that alternative diagnoses are common. DMCN 2024
  • Spanish prospective cohort (Armangué et al. 2024, Lancet Neurol) — compared algorithms head-to-head; mimics are common; false-positive serum antibodies also common. Specificity of Graus "possible AE" before infectious testing was as low as 8%. Specificity for "probable seronegative AE" rose to 99% when mimics were excluded. Lancet Neurol 2024
  • Mimics review (Neurol Neuroimmunol Neuroinflam 2023) — extralimbic MRI involvement, enhancement, diffusion restriction are more common in mimics than in AE. NXI
  • Pediatric cohort comparison (PMC9552833) — Cellucci and Graus sensitivities by day 28 both approach 90% when infectious workup is done promptly; specificity improves markedly once PCR and infectious serology come back. PMC9552833

Strength of evidence as applied to Levi

  • High that the correct framework for evaluating "is this seronegative pediatric AE?" is Cellucci 2020, applied with explicit ruling out of mimics (including metabolic, genetic, structural, and post-infectious causes).
  • Applied to Levi: Levi's workup is incomplete against Cellucci criteria because (a) CSF cytokines/AE panel/neopterin were not sent, (b) MRI is only sparsely characterized in the corpus, (c) infectious PCR on CSF is not documented, and (d) the January 2026 event was not worked up as a potential encephalitic trigger at the time.

Impact on Levi's workspace

  • Differential: classical-autoimmune-encephalitis remains low because the broad serum antibody panel is negative; however, a seronegative probable AE label is still on the table and is best evaluated formally under Cellucci criteria rather than rejected outright.
  • Diagnostics: strengthen repeat-lp-csf-cytokines-ae-neopterin with Cellucci reference; explicitly include CSF NMDA-R repeat testing (CSF is more sensitive than serum). Add a jan-2026-illness-record-review rationale tied to the Cellucci framework's requirement of considering infectious/parainfectious triggers.
  • People: add a pediatric neuroimmunologist with expertise in seronegative pediatric AE; cite Cellucci, Titulaer as authors worth engaging.

Claim 6 — Akkermansia muciniphila abundance in children has a bidirectional clinical significance: it is usually beneficial, but overabundance is not obviously pathologic and its specific association with ASD/neurodevelopmental phenotypes is inconsistent

What the literature says

  • Wang et al. 2011 (Appl Environ Microbiol) — foundational ASD-microbiome paper: children with ASD had lower relative abundance of Akkermansia muciniphila and Bifidobacterium vs. controls; interpreted as mucin-barrier dysregulation. PMC3187122
  • Meta-analysis and systematic review (Front Psychiatry 2019) — majority of studies report lower Akkermansia in ASD, but sequencing-based studies have sometimes reported the opposite. Front Psychiatry 2019
  • Recent machine-learning cross-study analysis (Sci Rep 2024) — finds a robust microbiome signature for ASD across studies but Akkermansia direction is not consistent. Scientific Reports 2024
  • Pediatric linear-growth study (DRC, Emerg Infect Dis 2023) — Akkermansia presence associated with improved linear growth and less diarrhea in young children, supporting beneficial role. PMC9796213
  • Immunomodulatory / barrier role (Frontiers 2022; Research 2023) — Akkermansia reinforces mucin layer and gut barrier; supplementation is generally considered beneficial in healthy states. PMC9300896 ; spj.science.org/research.0107
  • Caveats on overabundance — in MS (pre-therapy patients) and in some neurodegenerative contexts, increased Akkermansia has been reported with possible pro-inflammatory effects; post-antibiotic blooms occur; translocation is described in pancreatic disease. PMC6163243 ; Tandfonline Gut Microbes 2021

Strength of evidence as applied to Levi

  • Low. Levi's Akkermansia 5.3% (ref 0.7–3.25%) is modestly above the reference but the literature does not support this as a standalone disease driver. The sign of the ASD association is inconsistent and is anyway lower Akkermansia in most cohorts, not higher. Overabundance has been associated with pro-inflammatory skew only in specific disease contexts (e.g., untreated MS), not in a generalizable way that would make it a prime explanatory lead for DEE-SWAS.

Impact on Levi's workspace

  • Differential: keep gut-microbiome-driver at less_likely / low weight; add literature references; note explicitly that the direction of Akkermansia change most often associated with ASD is decreased, not increased, and that the lab's flag of "overabundance" is not a well-validated disease signal in isolation.
  • Diagnostics: repeat-microbiome-post-acute stays at low priority unless a gut-brain hypothesis is actively being pursued for other reasons (e.g., GI symptoms emerge or immunomodulation is chosen).
  • Treatments: no specific treatment action is supported by this evidence.

Claim 7 — Parainfectious encephalopathy in children is a real mechanism with diverse presentations (MERS, ANE, FIRES, ADEM), usually following a respiratory viral illness by days to a few weeks, and is mechanistically driven by innate immune overreaction rather than direct viral invasion

What the literature says

  • Post-COVID parainfectious encephalopathy (Frontiers in Immunology 2025) — review of the spectrum: MERS, ANE, FIRES, all mediated by innate immune overreaction; ranges from mild reversible (MERS) to catastrophic (ANE). Frontiers 2025
  • ANE review — typical 1–6 day latency from respiratory viral prodrome; bilateral thalamic lesions and elevated CSF IL-6 are hallmarks; RANBP2 susceptibility gene. ScienceDirect 2023
  • Post-infectious neurological syndromes review (Ital J Pediatr 2021) — ADEM is the most common pediatric post-infectious encephalopathy; latent period 1–2 weeks; multifocal self-limiting symptoms in most. Ital J Pediatr 2021
  • FIRES and CSF cytokines — Kothur et al. (above): FIRES CSF shows very high CXCL9/10/11, TNF-α, IL-6 signature; distinct from chronic epilepsy. PubMed 31283843

Strength of evidence as applied to Levi

  • Low-moderate. Levi does not have a classic parainfectious encephalopathy presentation (no ANE-like thalamic lesions, no MERS-like splenial lesion, no FIRES-like super-refractory status). However, the January 2026 leukocytosis episode followed by escalating regression is suggestive of a possible parainfectious trigger of DEE-SWAS in an already-vulnerable child — a two-hit model where the underlying vulnerability (possibly genetic overgrowth syndrome + already-present electrical abnormality) is precipitated into a full clinical syndrome by a subclinical or minor infection.
  • This model deserves a targeted record review (what happened January 16, 2026) and, where available, serology looking back at likely candidate viruses.

Impact on Levi's workspace

  • Differential: keep post-infectious-trigger-jan-2026 as a contributing factor (not a root cause) with likelihood around 10–15%; add references; explicitly note the "two-hit" framing.
  • Diagnostics: jan-2026-illness-record-review gains specificity; add viral PCR panel and viral serology retrospectives if clinically feasible.

Claim 8 — Iron deficiency, even without overt anemia, lowers seizure threshold and impairs cognition in young children; this is a well-documented amplifier, not a root cause

What the literature says

  • Hartfield et al. 2009, and multiple subsequent case-control studies — iron deficiency more frequent in children with febrile seizures and first unprovoked seizures; ferritin is the most useful biomarker. Seizure journal
  • Idjradinata & Pollitt 1993 and subsequent reviews — iron's role in myelination, monoamine neurotransmitter metabolism, and dopaminergic function; iron deficiency in infancy/toddlerhood produces lasting cognitive and behavioral deficits. Neurocognitive Dysfunction review
  • Meta-analysis on iron deficiency and febrile seizures (5–60 mo, PMC11024880) — consistently shows an iron-deficiency association; not all studies replicate. PMC11024880
  • Animal-model data (Rudisill et al. 2017, PMC5734468) — dietary iron deficiency lowers seizure threshold in a time- and sex-specific manner. PMC5734468
  • Ferritin interpretation caveat — ferritin is an acute-phase reactant; must be interpreted alongside CRP, especially in a child with recent inflammatory episodes. Folia Microbiol 2022

Strength of evidence as applied to Levi

  • High that iron deficiency is a clinically relevant amplifier of seizure susceptibility and cognitive dysfunction in Levi's age bracket. Levi's ferritin 27 (persistent low) and transferrin sat 13% with iron 16 (January 2026) constitute genuine iron deficiency worth correcting regardless of any other etiology.
  • Limit: iron deficiency does not explain overgrowth, DEE-SWAS, or the cytokine signature; it is an amplifier only.

Impact on Levi's workspace

  • Treatments: iron-repletion should be maintained as high-priority ranking; add references.
  • Differential: iron-deficiency-amplifier should be kept as an amplifying_factor with high likelihood-it-contributes, but low likelihood-it-explains-the-whole-picture. Refine the mechanism text to cite the animal and human seizure-threshold data.

Cross-cutting observations

  • The biggest avoidable missed measurement in Levi's workup was CSF cytokines / AE panel / neopterin at the April 7 LP, which the 2025 ESES CSF cytokine paper and the FIRES CSF cytokine paper both show are directly informative for the DEE-SWAS / seronegative inflammatory question. A repeat non-traumatic LP is the single highest-yield diagnostic intervention available to Levi now.
  • Methylation-array + epigenetic signature testing (EpiSign-class) is the most efficient single test for the epigenetic overgrowth differential — catches Sotos, Weaver, BWS, and several other PRC2-complex disorders at once. Trio WES adds the Mendelian and PI3K-AKT-mTOR coverage. Together they cover the top of Family A.
  • Mosaic / low-VAF variants are a real blind spot of blood-only WES — if blood-based trio WES and methylation come back negative but the overgrowth + epilepsy phenotype remains unexplained, the literature supports not stopping (consider deep targeted sequencing; affected-tissue sequencing is not easily obtainable without surgery but should be considered if surgery happens for any reason).
  • Steroid taper strategy matters — relapse is a real concern; a Buzatu-style long oral taper is literature-supported for DEE-SWAS specifically.
  • Avoid oxcarbazepine and carbamazepine — these can worsen spike-wave index in DEE-SWAS; this is consistent evidence across reviews.
  • Serum cytokine panels drawn after a steroid course cannot be cleanly interpreted — glucocorticoids affect Th1/Th17 balance; a repeat panel off-steroids is genuinely informative.
  • The Akkermansia literature does not support elevating the gut-microbiome-driver hypothesis on the basis of Levi's single abnormal abundance result.

What this memo is explicitly NOT saying

  • It is not claiming Levi has a specific genetic diagnosis. No molecular testing has been done in the corpus yet.
  • It is not claiming the Th1/Th17 serum signature proves CNS inflammation. That would require CSF cytokines or an off-steroid repeat.
  • It is not overriding the existing differential / diagnostics / treatments / people YAML files. It is the evidence layer those files should cite going forward.
  • It is not a substitute for subspecialty judgment.
DNMT3A and methylation-axis deep-dive (2026-04-17)

DNMT3A and methylation-axis deep-dive (2026-04-17)

Scope and trigger

User request on 2026-04-17 to do targeted research on DNMT3A and other methylation mechanisms, then reflect the result in the Root Cause Theories workspace. The goal is to separate the component of Levi's residual "epigenetic overgrowth" hypothesis that has been genuinely down-weighted by the three negative germline workups from the component that remains live because the assays used do not directly test it.

What the germline workups have and have not ruled out

Three negative germline readouts are on file:

  1. Stanford trio clinical exome — UNINFORMATIVE, 2025-05-29.
  2. GeneDx trio whole-genome sequencing — NEGATIVE, 2026-01-29.
  3. GeneDx genome reanalysis with updated HPO terms — NEGATIVE, 2026-04-09.

These workups adequately cover coding-region germline variants in DNMT3A, NSD1 (Sotos), EZH2 (Weaver), NFIX (Malan), SETD2 (Luscan-Lumish), ATRX, KMT2D (Kabuki 1), KDM6A (Kabuki 2), and adjacent chromatinopathy genes. They do not cover three specific mechanisms that are materially relevant to the methylation axis:

  • Mosaic / postzygotic variants in any of these genes. Explicitly excluded by design in the Stanford report; standard germline calling pipelines do not reliably call low-VAF variants in blood.
  • Methylation / imprinting defects at 11p15 (BWS spectrum), 5q35 (Sotos), 7q32, 14q32, and 15q11-q13. MS-MLPA and genome-wide methylation arrays test a functional readout that short-read WGS does not.
  • Deep-intronic, regulatory, or structural variants at epigenetic-regulator genes that fall outside standard clinical interpretation bins for short-read WGS.

An episignature / EpiSign panel addresses the methylation / imprinting component and functionally tests DNMT3A / NSD1 / KMT2D / ATRX activity regardless of whether a specific variant was captured. Independent validation gives it 100% sensitivity for DNMT3A (TBRS), NSD1 (Sotos), KMT2D (Kabuki 1), and ATRX and 100% specificity overall in one published cohort (van der Sanden 2023, Levy 2022).

Tissue-based mosaic-sensitive sequencing (buccal / skin) addresses the mosaic component. Both of these are currently tracked as the top two diagnostic items in Levi's diagnostics workspace (methylation-imprinting-panel rank 2; mosaic-sensitive-tissue-sequencing rank 1).

What DNMT3A / TBRS specifically brings to Levi's differential

Phenotype match (from Tatton-Brown 2018 cohort of 55 and the GeneReviews chapter):

FeatureTBRS cohortLevi
Symmetric proportional overgrowth from infancy83% (≥+2 SD height and/or HC)Yes, 99th percentile height, weight, HC from ~12 months
Macrocephaly at birthmean +2.3 SDNormal at birth, 99th pct by 12 months
Autism spectrum disorder36% of the full cohort (51% any behavioral/psychiatric)Formally diagnosed (Sutcliffe Clinic 2024-03-08)
Hypotonia54%Motor behavior compatible but not formally documented as hypotonic
Afebrile seizures22%Yes, DEE-SWAS 2026-03-10
Regression7% (mostly in adolescence)Yes, from ~2.5 years old with acute escalation at 5
DEE-SWAS / EE-SWAS specificallyNot characterized in 2018 cohort; one published case (Datta 2026)Yes

The match is good on the overgrowth + ID + ASD + seizure axis. The match is weak on the regression axis — TBRS-associated regression is usually adolescent, not early childhood. The DEE-SWAS-specific match relies on a single 2026 case report but that case report is directly phenotype-matched.

Neuroimaging: The reported TBRS imaging features (Jiménez de la Peña 2024) are corpus callosum anomalies, small posterior fossa (sometimes Chiari), asymmetric arcuate / uncinate fascicles, increased cortical thickness, and occasional isolated focal hyperintensities. Symmetric periventricular deep white-matter FLAIR signal is not a recognized TBRS imaging signature, and the specific pattern seen on Levi's April 7 MRI (nonspecific R>L periventricular FLAIR, otherwise structurally unremarkable, hippocampi normal, MRS unremarkable) does not match the TBRS imaging gestalt. That is a modestly negative imaging signal for TBRS but not decisive, because most of the TBRS imaging features require deliberate morphometric / DTI reads to detect.

Other methylation-axis hypotheses

Sotos / NSD1 (5q35): Germline NSD1 coding variants are effectively excluded by two trio workups. 5q35 microdeletions (5% of Sotos) and partial NSD1 deletions detectable by MS-MLPA remain untested in Levi; these are standard on methylation / imprinting panels. Sotos has an established episignature (100% sensitivity in the van der Sanden validation). Classical Sotos is not progressive — Levi's frank regression is atypical — but seizures occur in roughly 40–50% of Sotos patients (Fortin 2021) and the phenotypic spectrum is wider than the classical gestalt.

Weaver / EZH2: Coding variants excluded by trio workups. Classical Weaver features (camptodactyly, distinctive skin texture, Sotos-overlap facial gestalt) are not documented in Levi. Residual is in methylation / structural variants covered by the epigenetic panel.

BWS / 11p15 imprinting: Levi's phenotype is a poor match for classical BWS (no macroglossia, no omphalocele, no neonatal hypoglycemia, no hemihyperplasia, proportional rather than asymmetric overgrowth). Still worth including on the methylation panel at zero marginal cost and to close the branch cleanly (BWS GeneReviews).

Kabuki (KMT2D, KDM6A): Not a strong phenotype match for Levi (Kabuki features distinctive facial gestalt including long palpebral fissures, eversion of lower lid, large ears, and persistent fetal fingertip pads, none of which are documented). Kept as a low-prior addition to the epigenetic / chromatinopathy panel because the assay is bundled.

Other imprinted loci (7q32 SRS, 14q32 TS14, 15q11-q13 PWS/AS): None match Levi's phenotype well, but they are bundled in the same MS-MLPA / episignature ordering step and add diagnostic coverage for effectively no additional effort.

How this changes the differential workspace

  1. overgrowth-sotos-weaver-epigenetic — rename internally to capture that the residual is now specifically the methylation/imprinting mechanism, and expand the reasoning to explicitly name DNMT3A / TBRS as the single strongest residual chromatinopathy hypothesis and cite the Datta 2026 DEE-SWAS case. Likelihood stays at 8 (small net change, because the Datta case and the stronger literature support for EpiSign sensitivity are offset by the imaging mismatch and the low regression frequency in TBRS). Add Tatton-Brown 2018 cohort, TBRS GeneReviews, Jiménez 2024 imaging, Datta 2026 EE-SWAS case report, Levy 2022, van der Sanden 2023, Ciolfi 2024 chromatinopathies review, and BWS GeneReviews to key_references.
  2. overgrowth-pi3k-akt-mtor-axis, overgrowth-mosaic-mtor-pathway — no change; the methylation literature does not materially shift either.
  3. seronegative-cell-mediated-neuroinflammation, idiopathic-multifactorial-dee-swas, iron-deficiency-amplifier, post-infectious-trigger-jan-2026, classical-autoimmune-encephalitis, mitochondrial-primary, classical-ieom, gut-microbiome-driver, structural-vascular-perinatal — each reviewed against the new evidence; no likelihood change, but last_reviewed_at and last_review_reason updated to record the explicit per-theory reassessment.
  4. Add a new dedicated theory overgrowth-dnmt3a-tbrs (kind: root_cause, category: epigenetic_regulatory) to make the DNMT3A-specific component legible as a separate line item, because an EpiSign-positive result at DNMT3A would be a different diagnosis, a different surveillance program, and a different treatment conversation than a BWS- or Sotos-specific positive, and the DNMT3A/DEE-SWAS case match (Datta 2026) is specific enough to deserve its own row. Starting estimate 4%, confidence low. The parent overgrowth-sotos-weaver-epigenetic theory stays at 8 and covers the residual non-DNMT3A chromatinopathy / imprinting mass; the new theory is carved out of what was previously bundled into it (so the family total does not move).

Net conclusion

The methylation axis is not the most likely remaining explanation for Levi (mosaic mTOR-pathway variant and seronegative neuroinflammation remain higher), but it is the most testable remaining genetic residual because (a) the current diagnostics workspace already has methylation-imprinting-panel at rank 2, and (b) episignature testing gives a high-sensitivity functional readout for exactly the mechanism that Levi's three negative germline workups do not cover. The DNMT3A / TBRS component of that residual is meaningful enough to break out as its own differential item so that a positive or negative EpiSign at DNMT3A has a clear home in the workspace.

Key references

RHEB/mTOR mechanism: why a normal MRI does not down-weight mosaic mTORopathy (2026-04-18)

RHEB/mTOR mechanism: why a normal MRI does not down-weight mosaic mTORopathy (2026-04-18)

Scope and trigger

Jake uploaded Proietti Onori et al., PLOS Biology (2021), "RHEB/mTOR hyperactivity causes cortical malformations and epileptic seizures through increased axonal connectivity." Ingested into the research corpus as 2021-proietti-onori-rheb-mtor-axonal-connectivity.md. This note captures what the paper means for Levi's differential, diagnostics, and treatments in light of the April 7, 2026 brain MRI and the three negative germline workups.

Core mechanism the paper establishes

  1. The patient-derived RHEB p.P37L variant (Reijnders et al. 2017 — ID, megalencephaly, epilepsy) is GAP-resistant: it binds TSC1/TSC2 normally but escapes TSC-stimulated GTP hydrolysis, producing constitutive mTORC1 hyperactivity.
  2. In utero electroporation of RHEB-P37L into L2/3 somatosensory cortex of mice reproduces the full mTORopathy phenotype — neuronal hypertrophy, heterotopic nodules, disrupted lamination — and reliable spontaneous tonic-clonic seizures.
  3. Rapamycin rescues both the biochemistry and the seizures in already-affected adult animals, establishing mTORC1 hyperactivity as the ongoing driver rather than a developmental scar.
  4. The visible malformation is not the seizure focus. A subset of RHEB-P37L mice seize with no detectable heterotopic nodule on histology; conversely, stopping mTOR hyperactivity at P14 (after cortical layering has finished) leaves the malformation in place but prevents seizures.
  5. Seizures are driven by enhanced long-range axonal connectivity, not local circuit changes. RHEB-P37L neurons have enlarged axonal arbors and greatly increased contralateral callosal projections onto normal-appearing, genetically wild-type cortex. Selectively silencing vesicle release from RHEB-P37L neurons — or selectively silencing their contralateral terminals — abolishes seizures.

Why this matters for Levi right now

1. It protects the mosaic PI3K-AKT-mTOR hypothesis from a "normal MRI" down-weight

Levi's April 7, 2026 MRI was structurally unremarkable except for nonspecific R>L periventricular deep white-matter FLAIR signal — no cortical dysplasia, no heterotopia, no TSC stigmata, no hemimegalencephaly. The naive read of that finding is "lowers the prior for mTORopathy." The case overview already softens this to "does not exclude low-VAF somatic variants."

This paper provides a concrete mechanistic reason the softened reading is correct:

  • In mice with uniform IUE-driven overexpression — much higher effective dose than a low-VAF human mosaic — a fraction of animals still seize with no detectable nodule.
  • The ictal substrate extends far beyond the cells that carry the variant, via aberrant long-range axons onto normal-appearing cortex.
  • In a human low-VAF somatic scenario, the number of affected cells may be too small to produce an MRI-scale malformation, yet the same distributed-connectivity mechanism could still make widespread structurally normal cortex hyperexcitable.

This is exactly compatible with Levi's Stanford EMU findings — wake SWI 78%, sleep SWI 95–100%, multifocal discharges at O1/O2/P4/T3/T4-T6 — which are by definition bilateral, multifocal, and sleep-activated rather than one focal onset zone.

Conclusion: the structurally unremarkable MRI should not drop mosaic PI3K-AKT-mTOR below Theory 1 in the Root Cause Theories workspace.

2. It raises, not lowers, the value of tissue-based mosaic-sensitive sequencing

The diagnostics workspace already ranks mosaic-sensitive tissue-based sequencing (buccal swab / skin punch to a PROS or PI3K-AKT-mTOR panel) as #1. Proietti Onori et al. add two things:

  • RHEB needs to be on that panel with deep coverage. It is the gene whose patient variant they studied. Phenotypically, RHEB Reijnders 2017 cases (ID + megalencephaly + epilepsy) look like Levi.
  • The diagnostic argument should be phrased independently of MRI. The prior for finding a low-VAF mosaic variant is not conditional on seeing a malformation; the paper makes this explicit. If anything, a normal MRI in a case with this phenotype shifts the effective search toward lower-VAF, more distributed variants — still the same assay, still the same prior, arguably a higher value of information.

Concretely, the panel / gene list should include at minimum: RHEB, MTOR, AKT3, PIK3CA, PIK3R2, TSC1, TSC2, DEPDC5, NPRL2, NPRL3, PTEN. If the panel being considered excludes RHEB, that's a reason to swap or supplement.

3. It provides preclinical support for the mTOR-inhibitor contingent treatment

Rapamycin rescued seizures in adult RHEB-P37L mice — the biochemistry, the EEG correlates, and the behaviors normalized. Two planning implications:

  • The treatments workspace should carry mTOR inhibition (everolimus / sirolimus) as a contingent, diagnosis-triggered lever with non-trivial prior probability given the current differential, not as a distant footnote.
  • The Cre-ERT2 switch-off at P14 result is important: stopping mTORC1 hyperactivity after the malformation is frozen prevents seizures in mice. Clinically, this argues that mTOR inhibition could help Levi even if some subtle structural substrate has already been established, because the epileptogenic driver is ongoing signaling, not a fixed developmental lesion.

This doesn't move mTOR inhibition into "recommend now" territory — that still requires a molecular diagnosis — but it does reinforce it as the dominant mechanism-directed option conditional on a positive PI3K-AKT-mTOR finding on tissue-based sequencing.

4. It sharpens what the neuroradiology re-read should look for

The diagnostics workspace also ranks a specialized pediatric neuroradiology re-read of the April 7, 2026 MRI. Given Proietti Onori et al.:

  • Subtle heterotopic nodules at the white-matter / grey-matter junction are specifically plausible and the paper shows their absence does not exclude mTOR-driven seizures. A re-read looking for sub-centimeter / partially formed heterotopic nodules, blurred grey-white junctions, bottom-of-sulcus dysplasia, transmantle sign, and asymmetric cortical thickness is justified.
  • The R>L periventricular deep white-matter FLAIR asymmetry is worth re-characterizing with the question "is this a subtle mTORopathy white-matter signature (dysplastic axonal projections, myelination abnormality around mTOR-hyperactive cells) rather than nonspecific gliosis?"

5. It nominates a new (lower-priority) outreach target

The senior authors — Geeske van Woerden and Ype Elgersma at ENCORE / Erasmus MC in Rotterdam — run an active mTORopathy program with both mouse and patient-facing arms. They belong on the people-ranking workspace as a complementary outreach node to the Mirzaa / Poduri / Aldinger cluster, specifically for mechanism / therapeutic follow-up after any positive PI3K-AKT-mTOR result. This is a lower priority than the mosaicism-diagnostic outreach already tracked, but it is real.

What this paper does not tell us

  • It does not tell us that Levi has a RHEB variant. The most likely single gene in a mosaic PI3K-AKT-mTOR scenario is still PIK3CA or MTOR on base-rate grounds. RHEB is a phenotype-appropriate candidate, not a dominant one.
  • It does not tell us that a low-VAF RHEB / PI3K-AKT-mTOR variant is the correct explanation for DEE-SWAS specifically (vs. an mTOR-axis variant that causes autism + overgrowth for other mechanistic reasons and DEE-SWAS is produced by a second process). The paper's mechanism is permissive, not specific.
  • It does not tell us whether rapamycin would help a patient with this seizure phenotype (DEE-SWAS) in the absence of a detectable mTOR-axis variant. The mouse seizures are spontaneous tonic-clonic, not sleep-activated SWAS. Treatment decisions still require a molecular diagnosis.

Follow-on actions for the orchestrator

  • differential-update: reassess each Root Cause Theory one-by-one. Expected effect: strengthen sources on mosaic-pi3k-akt-mtor (Theory 1) and germline-pi3k-akt-mtor-missed (Theory 3), with an explicit note that structurally unremarkable MRI does not down-weight these theories. No expected rank change relative to the current top-of-file.
  • diagnostics-update: reinforce mosaic-sensitive-tissue-sequencing (rank 1) with an explicit requirement that RHEB be covered; adjust the specialized-neuroradiology-reread entry's question list to include subtle heterotopia / mTORopathy white-matter signature per this paper. No expected rank change.
  • treatments-update: strengthen the mTOR-inhibitor contingent entry with this preclinical evidence; keep its activation condition tied to a positive PI3K-AKT-mTOR finding.
  • people-ranking: add van Woerden / Elgersma at ENCORE / Erasmus MC as a long-tail mTORopathy-mechanism outreach target. Lower priority than the Mirzaa / Poduri / Aldinger cluster.
  • case-overview-maintenance: minor edit — the "structurally unremarkable MRI lowers the prior for a high-VAF mosaic mTORopathy but does not exclude low-VAF somatic variants" sentence can be strengthened with an explicit mechanistic citation to this paper. Not urgent.
Post-pulse methylprednisolone behavioral rebound at 2–6 weeks: literature review (2026-04-18)

Post-pulse methylprednisolone behavioral rebound at 2–6 weeks (2026-04-18)

Trigger

On 2026-04-18 Jake asked, in response to observing increased frustration and mild aggression in Levi: how frequent is a steroid rebound a few weeks after a pulse? Levi received methylprednisolone/prednisolone 20 mg/kg/day × 3 days IV on 2026-03-23 to 2026-03-25, with the post-pulse Stanford EEG on 2026-03-26 (sleep SWI 71.3%) and the UCSF EEG on 2026-04-06 to 2026-04-07 (qualitative "occasional bursts of multifocal spike-wave discharges at P7/F4/T8 and T7" — near-resolution). He is now ~3.5 weeks post-pulse and ~1 week post the cleaner UCSF EEG. The competing hypotheses are (a) post-pulse mood/behavioral aftermath, (b) developmental awakening with communication mismatch, and (c) subclinical SWI re-emergence.

This note captures the literature behind hypothesis (a) and updates the differential reasoning. The other two hypotheses are addressed in the answer that triggered this note but not separately re-derived here.

Headline finding

Behavioral worsening 3–6 weeks after a pediatric IV methylprednisolone pulse is a recognized but under-quantified phenomenon. There is no single prospective pediatric study that gives an absolute incidence rate at the 3.5-week mark for the regimen Levi received (single 3-day high-dose IV pulse without a tapered course). The closest anchors:

  • Adult IVMP cohort (Nishimura 2023): incidence of a clinically diagnosed corticosteroid-induced psychiatric disorder (CIPD) is ~6.1% in IVMP recipients (vs. 0.6% across all corticosteroid users), and post-pulse onset is more common than during-pulse onset within the IVMP-related CIPD subgroup (22.4% after vs. 14.1% during, of all CIPDs).
  • Adult MS prospective study (Lorefice 2018): mood changes after IVMP can be detected at the 1-month follow-up using validated mood instruments, with bipolar-spectrum-positive patients particularly vulnerable.
  • Adult MS short-term self-report (Morrow 2016): sleep disturbance (44%), agitation (36%), and behavioral changes (36%) are all common during and up to 1 week post-pulse — these are AE rates of the same order of magnitude as the most common physical AEs.
  • Pediatric APSE review (Stuart 2014): adverse psychological effects in children can occur at any point including after cessation; documented case reports describe psychiatric reactions beginning 1–11 days after corticosteroid administration was stopped, occasionally as combativeness and emotional lability rather than frank psychosis.
  • Pediatric ALL prospective behavioral study (Mrakotsky 2011): preschool children (<6 years) show clinically significant emotional dyscontrol, mood, and behavior regulation changes during a 5-day prednisone or dexamethasone course — and these changes return to baseline within 2 weeks of the course ending. School-age children show no comparable effect. This is the strongest data point arguing against a 2–3-week-later rebound for a clean cyclical exposure pattern; it does not extend to the high-dose IV pulse.
  • Glucocorticoid withdrawal syndrome (GWS) literature: GWS symptoms include irritability, mood changes, sleep disturbance, fatigue, myalgias; can develop during or after taper; mood changes have been documented to progressively worsen 5–12 weeks after acute withdrawal in adult cohorts; pediatric data are sparse but the symptom syndrome is recognized in children.

What this means quantitatively

  • A single absolute incidence rate of "behavioral rebound at 3–6 weeks post-IVMP pulse in a 5-year-old child with DEE-SWAS" does not exist in the literature.
  • The closest defensible synthesis: a clinically meaningful psychiatric AE in this temporal window is in the high single digits to low double digits of percent for IVMP recipients, and subclinical irritability and behavioral dysregulation are presumably much more common (the IVMP CNS-AE rates of 30–45% in self-report at 1 week post-pulse anchor the upper end of the plausible range for low-grade behavioral changes).
  • Among the patients who do develop AEs, the post-pulse window appears to be the more common emergence interval than the pulse itself, by Nishimura's IVMP-specific breakdown.
  • Pediatric behavioral susceptibility is age-dependent and dramatically higher in preschoolers than in older children (Mrakotsky), which makes Levi (5.5 years old) part of the higher-risk age band.

Why a 3.5-week post-pulse onset is plausible mechanistically

Three convergent mechanisms each predict a delayed window rather than an immediate one:

  1. HPA-axis recovery dynamics. Even a 3-day high-dose pulse measurably suppresses the HPA axis; full circadian-rhythm recovery in infants after oral steroid cessation has been measured at ~6 weeks, with HPA function normalizing over 10–12 weeks in most cases. The window of relative cortisol insufficiency overlaps the period when behavioral symptoms can emerge.
  2. Glucocorticoid withdrawal syndrome cytokine/prostaglandin rebound. The proposed mechanism for GWS is upregulation of cytokines and prostaglandins as supraphysiologic glucocorticoid concentrations decline. This is a delayed-onset mechanism by construction.
  3. Inflammatory rebound of the underlying disease. Levi's pre-pulse case included a Th1/Th17-weighted serum cytokine signature on 2026-04-06 with no identified infection. A pulse temporarily suppresses that signature; as suppression wanes, the underlying immunologic substrate that contributed to the DEE-SWAS phenotype can re-assert itself — affecting behavior even before SWI numbers move.

These three mechanisms are not mutually exclusive and would tend to compound.

Distinguishing post-pulse aftermath from SWI re-emergence

The pediatric DEE-SWAS literature is clear that relapse after pulse therapy is common and that conventional SWI improvement does not exclude continued subclinical activity:

  • The Wuxi Children's Hospital cohort (Frontiers 2024) constructed a relapse-prediction model from age at seizure onset and concomitant frontal-lobe discharges. Levi's UCSF EEG named F4 (right mid-frontal) as a focus for the first time across the three ingested EEGs — putting him in the higher-risk side of the model independent of his SWI drop.
  • Gong et al. (2019) showed that in pediatric CSWS the relapse subgroup had HFO detection rates of 81–100% at 2 weeks, 3 months, and 6 months post-pulse, while the same subgroup's ESES-pattern detection was only 27–55%. A "clean-looking" SWI EEG can sit on top of an HFO-level signal that predicts relapse.

So the SWI-re-emergence hypothesis is mechanistically live, but the available EEG would not have caught early re-emergence unless it was performed with quantitative SWI / HFO analysis — and it was not. Behavior is the leading indicator that should trigger a repeat quantitative EEG, not the other way around.

Differentiating signs to watch for over 1–2 weeks

Same diagnostic differentiators as in the chat answer, captured here so they survive the conversation:

  • Favors post-pulse aftermath / GWS-like rebound: diurnal pattern (worst late afternoon when endogenous cortisol nadirs), sleep-onset or early-waking disruption, fatigue or hypersomnia, eating changes, recently-regained skills (eye contact, AAC, imitation, climbing) preserved between episodes.
  • Favors developmental awakening with communication mismatch: frustration episodes are clearly tied to a denied or misunderstood request and de-escalate when the request is correctly identified or AAC-mediated; AAC use, eye contact, and imitation continue to trend up.
  • Favors subclinical SWI / HFO re-emergence: loss of recently regained skills, more zoning or staring, sleep that becomes restless or interrupted in the second half of the night, increased self-stim, and behavior that does not respond to communication scaffolding. This is the pattern that should pull the next quantitative SWI EEG forward rather than waiting for the scheduled one.

Implications for the workspaces

  • Differential / Root Cause Theories: this is not an etiologic update — post-pulse behavioral aftermath is a transient pharmacologic side-effect channel, not a competing root cause. The Th1/Th17-biased neuroinflammatory hypothesis (Theory 2 in the current ranked workspace) is mildly supported in the sense that any rebound of the underlying inflammatory substrate would be expected to amplify behavior; no re-rank is warranted from this evidence alone. Defer to differential-update if the current behavioral picture worsens, persists past 6–8 weeks post-pulse, or is accompanied by signs of skill regression.
  • Diagnostics: this evidence pushes the next quantitative SWI EEG up the priority list and adds an ask for the EEG team — ideally schedule sooner than current cadence if any of the SWI-re-emergence signs above appear, and ask explicitly about quantitative SWI and (where available) HFO analysis. Defer formal re-ranking to diagnostics-update in a follow-up run if Jake or Miki want this captured durably.
  • Treatments: argues for explicit pre-specified escalation triggers and a documented decision gate for whether to repeat a pulse, move to a tapered oral course, or hold; this is consistent with the existing treatment workspace's pulse-response durability item and does not by itself force a re-rank.
  • People: no change.
  • Providers: no change.

Open questions / next steps

  • A pediatric-specific prospective study of single-pulse IV methylprednisolone behavioral aftermath at the 3–6 week mark does not appear to exist. If a more thorough Elicit / PubMed pass is desired, the highest-yield search would target pediatric autoimmune / nephrotic / ADEM / DEE-SWAS pulse cohorts with parent-rated behavioral outcomes at ≥4 weeks post-pulse.
  • Whether to pre-position a brief parent behavior log (sleep onset, frustration episode count, AAC use frequency, recently-regained-skill checklist) as a structured daily journal for the next 2–3 weeks would meaningfully improve the signal-to-noise on which hypothesis is dominant.
  • Whether to ask Levi's neurology team for the next EEG to include quantitative SWI and HFO analysis, given the F4 frontal focus and the Wuxi/Gong findings, is a clinical-decision question worth raising with them.

Sources

2026-04-18 follow-up pass: pediatric cohorts with behavioral outcomes at ≥3 weeks

Trigger. After the initial literature pass, an audit of the 10 sources against two criteria — (a) IV methylprednisolone pulse specifically, and (b) outcomes at ≥3 weeks post-pulse — showed that only 1 source fully met both criteria (Lorefice 2018, adult MS), with Nishimura 2023 being the best IVMP-specific anchor but without a clean 1-month bin. Jake asked for a targeted second pass specifically in pediatric pulse-treated cohorts with behavioral outcomes at ≥3 weeks.

New sources added in this pass

  1. Soliman / Zagazig 2013 — pediatric nephrotic syndrome, n=30, ages 6–16

    • Regimen: oral prednisone over 7 weeks, not an IV pulse. This is the critical caveat.
    • Timepoints: baseline, weeks 1, 3, 5, 7.
    • Instruments: CDI, Children Anxiety Scale, Aggression Questionnaire (physical/verbal/hostility).
    • Finding: anxiety rose from mean 16.2 (baseline) to peak 27.9 at week 3, remaining elevated at 22.7 at week 7. Depression and aggression followed the same peak-at-week-3, still-elevated-at-week-7 trajectory.
    • Relevance to Levi: this is the closest pediatric study to the timeframe Jake and Miki are seeing. Supports the framing that "around 3 weeks in" is not a strange window for pediatric corticosteroid-related behavior changes to peak. But the exposure profile (continuous oral, 7 weeks) is different from Levi's 3-day pulse, so the parallel is mechanistic (HPA-axis / cytokine trajectory) rather than direct regimen-matched evidence.
  2. Mrakotsky 2013 — pediatric IBD on systemic corticosteroids

    • Second prospective study from the Mrakotsky group confirming acute behavioral and cognitive side effects of systemic steroids in children, in a non-oncology cohort.
    • Reinforces the age-dependent pattern (younger children more affected) without changing the overall picture.
  3. Pediatric autoimmune encephalitis cohort (Nosadini framework + Indian NMDAR case series)

    • Regimen: IVMP 30 mg/kg/day × 3–5 days followed by oral taper at 1–2 mg/kg/day for ~12 weeks. This is a closer pediatric IVMP match than MS or nephrotic syndrome — but it still differs from Levi's pulse-only course because it tails into a long oral taper.
    • In the Indian NMDAR series (n=21), 61.9% required psychotropic medication for behavioral symptoms during and after immunotherapy.
    • Mean time to significant clinical behavioral response: 7.4 ± 4.8 months (range 2–19 months).
    • In the pediatric AE cohort, ongoing behavioral difficulties in the 1-month-plus post-pulse window are common — but inseparable from residual underlying disease.

Quantitative anchor: "more than 90% by 6 weeks"

Across multiple pediatric and adult corticosteroid reviews, the recurring time-to-symptom-onset figure is:

  • Most pediatric/adult patients who develop corticosteroid-related psychiatric symptoms develop them within the first week.
  • More than 90% of those who develop any symptoms will have done so by 6 weeks.
  • This is specifically about symptom onset, not symptom resolution. It does not address whether symptoms that start at week 1 persist through weeks 3–6, or whether late-onset symptoms at week 3–6 represent a distinct "washout rebound" mechanism — the literature does not cleanly separate these two patterns.

Revised audit: how many sources now directly address your window?

After adding the three new entries the audit looks like this:

SourcePediatric?IV pulse?Outcome window ≥3 wk post-pulse?
Lorefice 2018 (MS pulse mood)No (adult)✓ (1 month)
Nishimura 2023 (IVMP CIPD)No (adult/mixed)partial (post-pulse > during-pulse; no 3–6-wk bin)
Stuart 2014 (pediatric APSE review)mixedpartial (1–11 days post-cessation cases)
Morrow 2016 (IVMP AE self-report)No (adult MS)no (max 1 wk)
Mrakotsky 2011 (DFCI ALL)no (5-day oral)partial (Days 0–21)
Mrakotsky 2013 (IBD)no (systemic oral)no (acute exposure only)
Soliman 2013 (nephrotic)no (7-wk oral)✓ (week 3 peak, still elevated at week 7)
Frontiers/Wuxi 2024 (EE-SWAS)✓ (pulse + taper)alternative hypothesis (relapse, not mood)
Gong 2019 (CSWS HFO)alternative hypothesis (HFO biomarker)
Nosadini 2020 + Indian NMDAR✓ (pulse + 12-wk taper)partial (behavior at follow-up, pulse-plus-taper)
Buzatu 2009 (CSWS corticosteroids)mixedno (relapse benchmarks)
GWS reviews (2023 / practical)mixedno (Cushing's withdrawal)✓ (5–12 wk worsening)

Net result after the follow-up pass: still zero pediatric prospective studies of single-pulse IVMP behavioral outcomes at ≥3 weeks post-pulse. The Soliman nephrotic study gives us a pediatric peak-at-week-3 trajectory but on oral continuous exposure. The pediatric AE cohort gives us pulse-plus-taper behavioral follow-up but cannot separate steroid effects from ongoing disease. The clean IV-pulse behavioral trajectory data we would want for Levi — pediatric, single 3-day pulse, no taper, parent-rated behavior at weeks 1 / 3 / 6 — does not exist in the indexed literature.

Updated quantitative summary

  • Absolute incidence of a clinically diagnosed steroid-induced psychiatric disorder after IVMP: ~6% of IVMP recipients (Nishimura 2023, adult), with the post-pulse window the more common emergence interval than the pulse itself.
  • Subclinical behavioral symptoms during or shortly after IVMP: 30–45% based on patient self-report at ≤1 week post-pulse (Morrow 2016, adult MS).
  • Pediatric behavior score trajectory on corticosteroids (oral, 7-week continuous): peak at week 3, still elevated at week 7 (Soliman 2013).
  • Pediatric behavior trajectory during a 5-day cyclical oral pulse (ALL protocol): peak at day 7, return to baseline by day 14 (Mrakotsky 2011). This is the one data point that argues against a 3-week-later rebound for cyclical short oral exposure — but it does not extend to a single 3-day high-dose IV pulse.
  • Symptom-onset temporal pattern across corticosteroid literatures: >90% of affected patients develop symptoms by 6 weeks, with most emerging in the first 1–2 weeks.

Revised interpretation for Levi

  • The second pass does not produce a clean pediatric IVMP-only study at the 3-week-post-pulse mark. That gap is the finding.
  • It also does not eliminate the plausibility of a post-pulse behavioral change in the 3-week-to-6-week window — the Soliman 2013 pediatric trajectory, the Lorefice 2018 adult 1-month signal, the Nishimura 2023 post-pulse > during-pulse pattern, the GWS 5–12-week worsening pattern, and the pediatric AE post-pulse behavioral difficulties are all consistent with "a few weeks later" being a real, mechanistically supported window rather than a temporal coincidence.
  • The Mrakotsky 2011 ALL data are the single counter-data point, and they apply to cyclical low-dose oral exposure — not to a single high-dose IV pulse.
  • Net recommendation unchanged from the original memo: treat post-pulse aftermath as a plausible contributor to Levi's current behavioral change, keep the developmental-awakening and subclinical-EEG-re-emergence hypotheses co-live, watch the differentiating signs, and move the next quantitative SWI / HFO EEG forward if skill-regression signs appear.

Sources (added in the 2026-04-18 follow-up pass)

Viswanathan 2024 DEE-SWAS etiology cohort — implications for Levi (2026-04-18)

Viswanathan 2024 DEE-SWAS etiology cohort — implications for Levi (2026-04-18)

Scope and trigger

On 2026-04-18, Jake uploaded the author-manuscript PDF (NIHMS-2009856) of Viswanathan et al., Ann Neurol 96(5):932–943 (November 2024), "Solving the etiology of Developmental and Epileptic Encephalopathy with Spike-Wave activation in Sleep (D/EE-SWAS)", and asked whether the paper was already in the corpus and for full downstream follow-through. It was not. This memo captures the Levi-specific consequences of ingesting it.

The paper matters because:

  • It is the single largest published cohort (n=101) assembled under the ILAE-2022 DEE-SWAS / EE-SWAS definitions — the exact diagnostic category Levi received at Stanford EMU on 2026-03-10.
  • It is authored by the two most visible DEE-SWAS etiology researchers globally (Ingrid Scheffer, Melbourne; Heather Mefford, St Jude) and represents a pooled Melbourne / St Jude / collaborator effort.
  • It refines the list of plausible single-gene and CNV etiologies and their proportional weights, which directly affects Levi's ranked differential.

Cohort at a glance

  • n=101 (Core 91 + 10 collaborator-referred solved cases); 44 DEE-SWAS + 47 EE-SWAS + 10 solved expansion.
  • 46% etiologically solved overall (Core); 66% DEE-SWAS vs. 28% EE-SWAS (adjusted p=0.007).
  • 20 single genes identified in 32 patients, 10 of them novel for D/EE-SWAS.
  • 6 CNVs in 7 patients, two novel (17p11.2 duplication not involving RAI1; 5q22 deletion).
  • 82% of MRIs were normal; structural cases clustered on the thalamocortical network.

The 20-gene DEE-SWAS map vs. Levi's current differential

Levi's differential (etiologies.yaml) currently has 13 theories. This paper mostly sharpens prior weights rather than introducing new ones. Gene-by-gene mapping:

Viswanathan 2024 geneFunctional classAppears in Levi's differential?Effect on Levi's weights
GRIN2ANMDA receptor (channelopathy)Implicit in idiopathic-dee-swas residual; not a dedicated theoryMost common DEE-SWAS gene (23% of solved); germline coverage should be explicitly confirmed in Levi's Stanford / GeneDx reports
GRIN2B, GRIN1NMDA receptorImplicitSame; covered by trio WGS at standard exome depth
SCN1A, SCN2ASodium channelImplicitCovered by prior workups
KCNQ3, KCNH5, KCNMA1Potassium channelImplicitCovered by prior workups
CACNA1ACalcium channelImplicitCovered by prior workups
ATP1A2Na/K-ATPaseImplicitCovered by prior workups
PPFIA3Synaptic scaffold / adhesionImplicitCovered by prior workups
CNKSR2X-linked, synaptic signaling scaffoldImplicitCovered; X-linked recessive not a match for Levi pedigree
CUL4BX-linked, ubiquitin ligase / chromatinImplicit; overlaps chromatinopathy-overgrowth-epigeneticX-linked recessive — unlikely pedigree fit
MECP2Rett; transcriptional repressorImplicit; classically X-linked femaleNot a phenotype match
FOXP1Transcriptional regulatorOverlaps chromatinopathy branchMild positive signal for chromatinopathy branch
PUF60 (Verheij)Spliceosomal regulatorOverlaps chromatinopathy branchMild positive
ARID1B (Coffin-Siris)BAF complex chromatin remodelerOverlaps chromatinopathy branchMild positive; BAF is adjacent to the SWI/SNF axis on EpiSign
SETD1BH3K4 methyltransferase; on EpiSignSquarely in chromatinopathy branchStrongest single positive for chromatinopathy / EpiSign priority
ZBTB18Zinc-finger transcriptional regulatorOverlaps chromatinopathy branchMild positive
NPRL2GATOR1 / mTOR regulatorSquarely in mtor-pathway-germline and mtor-pathway-mosaicOnly 1/20 genes in this cohort is in the mTOR axis; that patient also had polymicrogyria (a structural feature Levi lacks). Mild negative signal for the mTOR-axis theories as the specific driver of Levi's DEE-SWAS, distinct from the overgrowth phenotype.

Out of the 20 genes, the paper separates two significantly co-expressed brain clusters (BrainSpan data) by Monte Carlo:

  • Cluster 1 (ion channels + scaffolding + adhesion): GRIN2A, GRIN2B, KCNH5, KCNQ3, CACNA1A, GRIN1, PPFIA3, SCN2A, CNKSR2, SCN1A, KCNMA1. (p=0.0002)
  • Cluster 2 (transcriptional regulators / chromatin modifiers): FOXP1, PUF60, CUL4B, MECP2, ARID1B, SETD1B, ZBTB18. (p=0.04)
  • Outliers: ATP1A2, NPRL2. NPRL2 is explicitly called out as the GATOR1 / mTOR regulator.

That clean separation into two co-expressed modules is relevant: Levi's differential has one major chromatinopathy branch (Cluster 2) and one major mTOR branch (outlier). Cluster 1 is effectively covered by "residual idiopathic channelopathy" in the current ranking, and no single channelopathy gene has enough specificity to warrant its own theory once germline trio WGS has been negative and reanalyzed.

Where this moves Levi's theories

mtor-pathway-germline and mtor-pathway-mosaic

Mild negative. The largest published DEE-SWAS cohort to date assigns only 1 of 32 gene-solved patients to an mTOR-axis gene, and that single case (NPRL2) had polymicrogyria — a structural MRI feature Levi's April 7 MRI does not show. Two important caveats temper how much this should down-weight:

  1. Levi's overgrowth is not a DEE-SWAS feature, it is a parallel phenotype. Viswanathan 2024 does not systematically report body-size percentiles or overgrowth, so patients with DEE-SWAS plus overgrowth are not separately enriched or depleted in this cohort. The mTOR theories in Levi's differential are specifically motivated by the conjunction of overgrowth + DEE-SWAS, not by DEE-SWAS alone.
  2. The mosaic branch is partly insulated because high-VAF mosaic mTORopathies generally have detectable MRI signatures, and the Viswanathan cohort was dominated by structurally normal MRIs (82%). Mosaic mTORopathy in blood-normal, MRI-normal DEE-SWAS is still a niche but defensible hypothesis.

Net effect: do not change the rank of mtor-pathway-germline (currently 10%) or mtor-pathway-mosaic (currently 15%) based on this paper alone. Flag the mild negative and fold it into the next full differential pass.

chromatinopathy-overgrowth-epigenetic and the dnmt3a-tbrs subtheory

Positive signal. 7/20 genes are transcriptional regulators / chromatin modifiers, and they form a significantly co-expressed cluster. SETD1B is explicitly on the EpiSign panel. ARID1B (Coffin-Siris) and CUL4B both overlap with the SWI/SNF / ubiquitin axis that EpiSign covers. This directly reinforces the priority of the methylation / imprinting panel (diagnostics rank 2) and the separate EpiSign / episignature panel motivated by the 2026-04-17 DNMT3A deep-dive.

DNMT3A itself is not in the Viswanathan 20-gene list, which is neither a negative nor a positive signal given the cohort size; the Datta 2026 case report remains the only published DNMT3A/TBRS + DEE-SWAS evidence, and this paper neither confirms nor excludes that pattern.

Net effect: strengthens the argument for ordering a single combined EpiSign + MS-MLPA panel rather than gene-by-gene follow-up. Does not change the rank of the chromatinopathy theory but reinforces the diagnostic priority.

idiopathic-dee-swas

Reinforced as a real category, not a placeholder. The paper leaves 54/101 (54%) unsolved in the Core cohort, including known DEE-SWAS cases from a high-yield research platform. Levi is in that residual majority. "Idiopathic" here means "no single-gene / CNV / structural etiology identifiable with current assays," not "noise."

Net effect: keep rank (15%) but improve the provenance of the rationale by citing the 46% overall / 54% residual split.

structural-vascular-perinatal

Confirmed down-weight. Of the 12 structural-MRI D/EE-SWAS cases in the cohort, all fit a thalamocortical-network pattern: 5 polymicrogyria (bilateral perisylvian or unilateral), 5 unilateral non-progressive thalamic lesions, and 2 post-hemorrhagic hydrocephalus with VP shunts. Levi's April 7, 2026 MRI shows nonspecific periventricular deep white-matter FLAIR asymmetry (R>L) and otherwise unremarkable structural imaging — no PMG, no thalamic lesion, no hydrocephalus. This pattern is atypical for a structural DEE-SWAS etiology.

Net effect: no change to the current low rank (3%) but the reason for the low rank is now well-referenced rather than vibes.

No other theories materially moved

infection-immune-encephalopathy, autoimmune-cell-mediated, metabolic-mitochondrial, toxic-exposure, and the EEG-technical / false-positive theories are not addressed by this paper.

Diagnostic consequences

  1. Add a diagnostic item: "GRIN2A coverage confirmation against Stanford / GeneDx reports." GRIN2A is the single highest-yield DEE-SWAS gene, accounting for 23% of solved Core cases. The three negative germline runs should have covered it at adequate depth, but a small follow-up question to confirm GRIN2A coding and canonical-splice coverage in the actual report PDFs is cheap and closes an important residual uncertainty. This is a rank ~10–11 item (below the top priorities, above generic residual gene-by-gene follow-up).
  2. Reinforce methylation / episignature panel priority (rank 2). 7/20 genes in this cohort are transcriptional regulators/chromatin modifiers and SETD1B is on the EpiSign panel. Do not re-rank — already rank 2 — but cite this paper in the evidence for it.
  3. No change to mosaic-sensitive tissue sequencing (rank 1). The paper does not speak to the mosaic-mTOR branch. Rank 1 is held because of the combined overgrowth-plus-DEE-SWAS phenotype, not because of DEE-SWAS alone.

Treatment consequences

  1. Add a contingent treatment note: "L-serine for GRIN-null variants." Viswanathan 2024 cites Krey et al. 2022 for L-serine therapy improving behavior, EEG, and seizures in GRIN2A / GRIN1 / GRIN2B loss-of-function patients. This is contingent — Levi has no identified GRIN variant — but worth capturing so it is immediately available if a GRIN call surfaces after tissue sequencing or reanalysis.
  2. No change to steroid-response or acute management. The paper does not address steroid pulses, methylprednisolone, or cannabidiol in DEE-SWAS.

People / outreach consequences

Both senior authors are reasonable outreach candidates and neither is currently in people.yaml:

  1. Heather Mefford (St Jude Children's Research Hospital). Co-senior author. Previously at Seattle Children's / University of Washington with Ghayda Mirzaa (already in Levi's people workspace), and her interest in DEE-SWAS etiology overlaps directly with the tissue-based mosaic sequencing question. The Seattle / St Jude axis is the natural venue for this kind of collaboration. Good outreach candidate at medium-high priority.
  2. Ingrid Scheffer (Austin Health, University of Melbourne). Senior author; globally the most visible epilepsy-genetics clinician-scientist on DEE-SWAS. Her group maintains the Melbourne Epilepsy Genetics database that produced this cohort. High-authority but geographically remote; outreach is reasonable if the family is open to cross-hemisphere correspondence. Medium priority relative to US-based PIs.

Other co-authors named on the paper (Oliver, Regan, Schneider, Myers, Howell, Symonds, Brunklaus, Sadleir, Zuberi, Hildebrand) are in the second tier of outreach value given the senior-authored nature of the work.

Open items

  • The paper is the author-manuscript NIHMS version; check the published journal version once accessible for any late corrections or supplementary tables not in the NIHMS preprint.
  • The paper does not disaggregate DEE-SWAS with vs. without overgrowth. A targeted literature pass on "DEE-SWAS with somatic overgrowth" remains open and could sharpen the weight on the mTOR-axis theories.
  • GRIN2A coverage confirmation against the Stanford and GeneDx report PDFs is the single cheapest follow-up that falls out of this paper.

Provenance

DEE-SWAS/CSWS/LKS recovery and mixed-valence behavioral emergence: is Levi's current picture characteristic? (2026-04-19)

DEE-SWAS recovery and mixed-valence emergence: is Levi's current picture characteristic? (2026-04-19)

Trigger

On 2026-04-19 Jake and Miki described a new, intense, mixed-valence behavioral picture in Levi:

New negatives over the last ~1 week:

  • Elopement (new)
  • Putting his hand in the toilet (novel sensory-seeking / boundary-testing)
  • Increased frustration and mild aggression
  • Toileting regression — near-perfect for ~2 months, then three accidents today

New positives co-occurring in the same window:

  • First-time fork use
  • Better eye contact
  • More recognition of family members around him
  • More proficient nonverbal communication
  • Possible (uncertain) language emergence — unclear whether mis-hearings or real

The timing markers matter: Levi finished his 3-day IV methylprednisolone pulse on 2026-03-25, the UCSF outpatient video-EEG on 2026-04-06–07 showed near-total electrographic resolution (only occasional multifocal bursts at P7/F4/T8/T7), and the bad-behavior acceleration started roughly 2026-04-12 onwards — so ~3.5 weeks post-pulse and 6–11 days post-clean EEG.

The question: is a mixed-valence surge of this kind characteristic of recovery from ESES / CSWS / DEE-SWAS / Landau-Kleffner syndrome?

This memo is specifically a follow-on to the 2026-04-18 steroid-pulse-rebound memo (content/research/notes/2026-04-18-steroid-pulse-rebound-behavior.md). That memo covered one hypothesis (post-pulse behavioral aftermath) in depth. This memo covers the complementary question — recovery-trajectory literature and developmental-awakening framing — and stitches the four live hypotheses into a single framework.

Headline finding

Mixed-valence behavior during the first weeks to months after apparent electrographic suppression of CSWS/LKS/DEE-SWAS is reported in the literature as a real and well-precedented phenomenon, but there is no single prospective study that describes it as a stereotyped "recovery syndrome" the way the GWS or APSE literatures describe corticosteroid side effects. The closest theoretical anchor is the paraictal-phenomenon framework (Morrell 1995, Grote 1999, Irwin 2001): after electrographic suppression in LKS/CSWS, behavior improves first and fast (consistent with Levi's new positive gains) while language and higher cognition improve slowly. The new negative behaviors Levi is showing are not predicted by that framework in isolation; they require a second mechanism (developmental-age catch-up / behavioral unmasking, and/or post-pulse aftermath) layered on top.

The practical upshot: the mixed pattern itself is more characteristic of a combination of genuine recovery plus post-pulse behavioral aftermath plus developmental-age catch-up than it is of subclinical EEG relapse. Pure relapse would typically show loss of recently gained skills, not co-emergence of new gains.

Four hypotheses, side by side

Hypothesis A — Developmental re-awakening with communication mismatch (behavioral unmasking)

Evidence base: LKS/CSWS recovery literature (Morrell 1995, Grote 1999, Irwin 2001, MDPI 2024 update); autism regression / catch-up literature (Tan 2021 bayonet-shaped language profile, Ozonoff & Iosif 2019); general elopement literature in autism showing it is usually goal-directed and tied to gained-but-not-yet-adequate communication ability.

Mechanistic story. During the active-SWAS period, cortical networks — especially frontal, parietal, and temporal — are bombarded by sleep spike-wave discharges that disrupt ongoing memory consolidation and new learning, and that also disinhibit frontal-executive control during wake. The child's effective behavioral developmental age lags his chronological age. When the SWAS quiets, two things unlock in parallel:

  1. Positive: the cortical substrate that drives engagement, social attention, imitation, and nonverbal communication starts working again. New skills appear (fork, eye contact, recognition, nonverbal communication, possible language). This is the paraictal behavior-before-language pattern — behavior and pre-linguistic communication improve first; formal language lags because the synaptic repair timeline is measured in months, not weeks.
  2. Negative: the child is behaviorally encountering the world more densely than he has in months. He has more curiosity (toilet-water play), more exploratory drive (elopement), more agency, and more frustration — because he is now aware enough to have specific wants and plans, but not yet fluent enough to express them. The LKS review literature repeatedly documents that frontal-lobe discharges during active disease drive hyperactivity, aggression, and disinhibition (78–80% prevalence during acute LKS); when those discharges quiet, the child's capacity for goal-directed action returns before his capacity for goal-appropriate self-regulation.

How Levi's picture fits. Very well. The positive half of Levi's picture is nearly a textbook paraictal-recovery description. The negative half — elopement, sensory play with novel objects, mild aggression, toilet accidents — reads as the behavior profile of a ~3-year-old whose vocabulary and self-regulation have not yet caught up to his emerging agency. Toileting regression is a particularly generic marker of any neurologic or developmental perturbation, and it is expected in this frame as a transient side-effect of the massive re-routing of attention onto new skills.

How it would fail the case. If the negatives grow without the positives consolidating — if fork use regresses, eye contact falls off again, or AAC use drops — then this framework is wrong and we need hypothesis C or D.

Hypothesis B — Post-pulse / GWS-like / HPA-recovery behavioral aftermath

Evidence base: covered in depth in content/research/notes/2026-04-18-steroid-pulse-rebound-behavior.md. Stuart 2014 pediatric APSE review (psychiatric reactions 1–11 days after cessation, up to weeks later); Soliman 2013 pediatric nephrotic week-3 behavior peak; Nishimura 2023 IVMP post-pulse CIPD incidence ~6% with post-pulse onset more common than during-pulse; GWS 5–12-week worsening pattern.

Mechanistic story. A 3-day high-dose IV methylprednisolone pulse temporarily suppresses the HPA axis. Recovery of the circadian cortisol rhythm and full HPA axis function can take 6–12 weeks in children. During this window, cortisol-related mood regulation, sleep architecture, and stress tolerance are impaired; cytokines and prostaglandins may transiently rebound (a GWS-like phenomenon); and the underlying inflammatory substrate that contributed to the DEE-SWAS may partly re-assert itself even before SWI numbers move. This is a pharmacologic side-effect channel, not a recurrence of the underlying disease.

How Levi's picture fits. Partially. The timing (3.5 weeks post-pulse) sits in the plausible window. The specific behaviors — irritability, aggression, sleep disruption, toileting accidents — are exactly what the GWS and pediatric APSE literature describe. The new positives, however, do not fit this hypothesis; pure post-pulse aftermath does not generate novel developmental gains, only negative behavior changes.

How it would fail the case. If the negatives resolve on a timeline longer than the HPA-recovery window (>2 months from pulse end, i.e. past late May 2026) and still look post-steroidal (no new gains, diurnal worst-in-late-afternoon pattern, sleep/eating changes), then this alone is a weak explanation. Conversely, if most of the negatives resolve by ~6–8 weeks post-pulse (i.e. by mid-May 2026), this hypothesis gains a lot of credibility.

Hypothesis C — Subclinical SWI / HFO re-emergence

Evidence base: Gong 2019 (pediatric CSWS relapse cohort with 81–100% HFO detection at 2 weeks / 3 months / 6 months post-pulse, even when only 27–55% showed ESES-pattern EEG); Frontiers/Wuxi 2024 (relapse-prediction model identifying age at seizure onset and frontal-lobe discharges as predictors); Kotagal 2017 pooled data showing ~29% 1-year relapse rate after pulse corticosteroid therapy in CSWS.

Mechanistic story. The qualitative UCSF EEG called out "occasional bursts of multifocal spike-wave discharges at P7/F4/T8 and T7" — and F4 (right mid-frontal) is new across the three ingested EEGs. In the Wuxi/Frontiers relapse model, concomitant frontal-lobe discharges are a predictor of relapse. In the Gong HFO series, relapse-bound patients often had clean-looking SWI but abnormal HFO burden. A qualitative "near-total resolution" EEG without quantitative SWI analysis or HFO analysis cannot rule out early subclinical re-emergence.

How Levi's picture fits. This is the worrying hypothesis. The literature linking frontal-lobe discharges in CSWS/LKS to exactly the observed behavioral profile (hyperactivity, aggression, disinhibition, impulsivity) is well established and anatomically plausible — F4 sits in right inferior frontal territory where disinhibition syndromes arise. But the co-occurrence of new positive developmental gains is not typical of active-disease return; pure relapse would more commonly show loss of recently gained skills.

How it would fail the case — or confirm it. If Levi's recently-gained positives are preserved between episodes (eye contact still there between frustration bouts; fork use still working; AAC engagement continuing to rise), relapse is less likely. If the positives start to fade, relapse moves up rapidly. The specific "canary" signs are: loss of recently regained skills, more zoning/staring, restless or fragmented sleep in the second half of the night, more self-stim, behavior that does not respond to communication scaffolding.

Hypothesis D — Cross-cutting: HPA-axis / hypothalamic contribution (newly added 2026-04-19)

Evidence base: content/research/notes/2026-04-19-hpa-axis-evidence-synthesis.md (cross-cutting contributing-factor theory added to the differential at 15%); Kessi 2019 CSWS pathogenesis paper identifying reduced GH/melatonin and elevated IL-6 as mechanistic contributors; Peng 2020 HPA dysfunction in epileptic spasms; Balbo 2010 sleep–HPA bidirectional regulation.

Mechanistic story. Levi has a pre-existing 1.5-year history of recurrent 3 AM stimmy nocturnal awakenings with food-seeking that the new HPA-axis literature pass has framed as a hypothalamic-syndrome-pattern feature that predates the April 2024 regression. A post-pulse HPA axis disruption overlaid on a pre-existing hypothalamic dysfunction substrate is a worse perturbation than either alone and predicts worse sleep, worse circadian cortisol, and worse stress tolerance than would be expected from the pulse alone.

How Levi's picture fits. Not a primary driver of the positive gains, but a plausible amplifier of the negatives. This hypothesis mostly affects how long the rebound takes to resolve and how well Levi handles the behavioral load of the developmental surge.

What the literature explicitly says about mixed-valence recovery

Three passes through PubMed / Web literature surface the following direct statements:

  1. The paraictal framework (Irwin 2001): "MST appeared to yield an early and quite significant improvement in behavior, while recovery of language functions was slower to become apparent. The difference in the timing of improvement between behavior and language functions suggests that behavior problems may represent an expression of a paraictal phenomenon. Language deficits, on the other hand, may result from a complex disruption of synaptic connections in language cortex by the constant 'bombardment' of epileptic activity, which may require a longer time to 'be repaired.'" This is the strongest single anchor for predicting that behavior moves first and that the direction of movement should be improvement — but it does not predict co-emergent new negatives.

  2. The dissociation between EEG and behavior (Hempel 2019 + MDPI 2024): pulse-prednisone language/behavior improvement is ~59% and is not significantly related to resolution of ESES on EEG. A clean EEG does not guarantee clinical gain, and behavioral gain does not require a clean EEG. This explicitly removes the expectation that Levi's behavior should look monotonically better because his EEG looks better.

  3. Behavioral disturbances can persist after EEG remission (MDPI 2024): "Behavioral change most often is characterized by hyperactivity and increased aggression and may persist even with remission of ESES." This is direct literature support for Levi's negative behaviors being compatible with successful electrographic recovery, not evidence against it.

  4. Across CSWS/LKS surgical and medical cohorts, complete neurobehavioral recovery is the minority outcome. In one cohort of 21 children in remission from ESES, only 5 achieved complete neurobehavioral recovery. Mixed / partial recovery is the rule.

  5. No prospective study explicitly describes a "new negative behaviors + new positive gains" mixed-valence pattern as a stereotyped CSWS recovery syndrome. The closest the literature gets is parent-reported narratives (e.g., the Mayo Clinic Connect thread where a parent observed returning impulsivity while the EEG stayed cleaner) and the scattered acknowledgment that behavior and EEG can dissociate in both directions. The absence of a sharp literature description is itself informative: what Levi is experiencing is not rare enough to be surprising, but it has not been separately quantified.

Why the mixed pattern specifically supports "recovery + aftermath + unmasking" over "relapse"

Three features of Levi's presentation tilt toward hypothesis A + B rather than hypothesis C:

  1. New skills are appearing, not disappearing. Fork use, recognition, eye contact, and nonverbal communication gains are consistent with continuing electrographic suppression. Relapse would more commonly present as loss of recent gains — not their acceleration.

  2. The negatives are developmentally directional. Elopement is goal-directed behavior. Toilet-water play is curiosity-sensory exploration. Aggression is frustration with an unmet communication need. These read as too much new agency rather than regressing back toward pre-pulse disengagement. A child in active relapse typically becomes less engaged, less curious, more zoned — not more adventurous.

  3. Toileting regression is a generic perturbation marker. The autism-toileting literature and the autism-regression literature both document toileting breakdown as an early and nonspecific marker of any neurologic, emotional, or developmental change. Three accidents on a day when Levi is also showing first-time fork use and new frustration is most parsimoniously a regression caused by the developmental surge consuming his attention, not a regression of its own.

That said, hypothesis C is not ruled out, and the frontal-lobe focus (F4) is a concrete reason not to dismiss it. The next quantitative SWI / HFO EEG — with HFO analysis, not just conventional SWI — is the right test to settle it, and pulling that EEG forward is the single highest-value diagnostic move right now if the positives start to fade.

Differentiating signs to track over the next 1–2 weeks

Carried forward from the 2026-04-18 memo and refined here for today's picture:

Favors hypothesis A (developmental re-awakening)

  • New positives continue to accumulate (more AAC, more imitation, more sustained attention, more language attempts even if rare).
  • Frustration episodes are clearly tied to a denied or misunderstood request and de-escalate when the request is correctly identified or AAC-mediated.
  • Elopement is goal-directed (going somewhere, wanting something) rather than confused/disoriented.
  • Toileting accidents cluster in moments of high engagement with new activities rather than appearing across the day.
  • Positives are preserved between negative episodes (he still uses the fork after having an aggressive moment; he still makes eye contact after eloping).

Favors hypothesis B (post-pulse / GWS-like rebound)

  • Diurnal pattern with late-afternoon worst window (when endogenous cortisol nadirs).
  • Early-waking or sleep-onset disruption, fatigue or hypersomnia.
  • Eating pattern change beyond the pre-existing nocturnal hyperphagia baseline.
  • Negatives trend downward over 4–8 weeks post-pulse (i.e. resolving by mid-to-late May 2026).

Favors hypothesis C (subclinical SWI / HFO re-emergence)

  • Loss of recently gained skills (fork use regresses, eye contact falls off, AAC use drops).
  • More zoning or staring, decreased reactivity to name.
  • Sleep becomes restless or fragmented in the second half of the night — which is where SWAS would be densest.
  • Increased self-stim or return of pre-pulse stim patterns.
  • Behavior that does not respond to communication scaffolding and is not clearly tied to frustration context.
  • Any increase in observed clinical seizure activity, even subtle (staring, head drops, jaw clench, arrest of activity).

Favors hypothesis D (HPA / hypothalamic amplifier)

  • Worsening of the pre-existing 3 AM stimmy nocturnal awakenings in frequency or intensity.
  • Post-stress behavioral crashes disproportionate to the stressor.
  • Temperature instability more noticeable than baseline.

Implications for the workspaces

Differential / Root Cause Theories (content/differential/etiologies.yaml)

  • No re-rank. This is not a root-cause update. Each of the four hypotheses in play here is either a transient side-effect channel (B), a transient recovery dynamic (A), a contributing-factor theory already captured (D), or a monitoring signal for the existing neuroinflammatory theory (C).
  • A formal differential-update reassessment at the end of this run should confirm that each existing theory has been reviewed and that no theory's rank changes from this evidence alone.

Diagnostics (content/diagnostics/diagnostics.yaml)

  • The next quantitative SWI / HFO EEG should move up the priority list if the hypothesis-C signs above appear. The concrete ask for the EEG team is:
    • Quantitative SWI (not just a qualitative read).
    • HFO analysis where available (Gong 2019 precedent).
    • Explicit comment on frontal-lobe focus continuity (F4 appeared for the first time on UCSF; is it still there?).
  • Parent behavior log (a structured daily journal covering sleep onset/fragmentation, frustration-episode count, AAC use frequency, preserved-skill checklist, and any seizure-semiology concerns) is worth pre-positioning to improve signal-to-noise on which of the four hypotheses dominates. This is low-cost and high-value given the mixed picture.
  • The HPA-axis diagnostics from the 2026-04-19 HPA memo (AM cortisol, 4-point salivary cortisol, IGF-1/IGF-BP3/prolactin panel, actigraphy) remain at their current rank. If the late-afternoon pattern characteristic of hypothesis B becomes obvious, the 4-point salivary cortisol moves up in relative priority.

Treatments (content/treatments/treatments.yaml)

  • No re-rank. This evidence supports the existing plan: hold and document the March 2026 steroid response, pre-specify escalation triggers, maximize speech/OT/AAC support during the electrographic-suppression window, and do not rush to repeat a pulse on the basis of behavior alone.
  • One substantive addition: if the hypothesis-A pattern is dominant, functional communication training (FCT) / AAC scaffolding becomes the highest-yield behavioral lever in the next 2–4 weeks. FCT is the evidence-based treatment of choice for elopement-as-goal-directed-behavior and for frustration-driven aggression in communication-delayed children (Autism Research Institute FBET framework). This is not a new treatment item — it is an intensification of the existing speech/OT/AAC priority during the post-pulse window.
  • If the hypothesis-B pattern is dominant, the implication is behavioral containment and patience (sleep hygiene, structure, de-escalation support) rather than a second steroid pulse; GWS-pattern symptoms resolve on their own timeline.
  • If the hypothesis-C pattern emerges (loss of gains), the next quantitative EEG and a pre-specified decision gate on whether to repeat a pulse or move to an extended tapered oral course becomes urgent.

People (content/people/people.yaml)

  • No change. No new outreach targets triggered specifically by this memo.

Providers (content/providers/providers.yaml)

  • No change. No provider updates triggered.

Case overview (content/case-overview.md)

  • No change. The high-level case picture is not altered; this is a bounded, time-limited interpretive frame for the current behavioral window.

Open questions / next steps

  1. A pediatric prospective study of mixed-valence behavioral trajectory specifically during the first 2 months after a single high-dose IV methylprednisolone pulse in DEE-SWAS / CSWS / LKS does not appear to exist. The Hempel 2019 and Viswanathan 2024 cohorts are the best available anchors but neither characterizes mixed-valence trajectories as a separately-measured outcome.
  2. Whether to ask the UCSF / Stanford neurology team for the next EEG to include quantitative SWI and HFO analysis, given the F4 frontal focus on the April 6–7 UCSF study, is a clinical-decision question worth raising explicitly in the next neurology touchpoint.
  3. A structured 2-week parent behavior log would meaningfully sharpen which hypothesis is dominant and would be cheap to produce. Template-worthy columns: sleep onset, number of nocturnal wakings, time of first wake, frustration-episode count, elopement attempts, AAC use frequency, fork/utensil use today, eye-contact notes, any seizure-semiology concerns, any zoning-out observed.
  4. Whether to explicitly ask Levi's developmental-pediatrics or behavioral-health contacts about introducing or intensifying Functional Communication Training (FCT) during this recovery window is the single highest-leverage behavioral intervention the literature supports in this specific situation.

Sources


Addendum — 2026-04-19 (same day, user-supplied report integration)

Later on 2026-04-19, Jake submitted an external research report ("Mixed Regression and Gains After ESES Normalization: A Characteristic Recovery Signature") and asked us to review it and take what's useful. That audit is documented in full in the companion memo content/research/notes/2026-04-19-report-review.md. This section captures the substantive framings from that report that enrich the four-hypothesis framework above.

Two citation errors were found in the user's report (documented in the report-review memo) and should not be propagated. Two claims could not be verified from abstracts alone and are flagged as paraphrase-pending-full-text. The rest of the scientific backbone is solidly sourced and worth integrating.

New framing 1 — Sleep homeostasis as the mechanistic substrate for the positive gains

The single most load-bearing addition to the memo. Four papers form a coherent pre/during/post arc:

  • Tassinari 2009 (Epilepsia 50 Suppl 7) — coined "Penelope syndrome": children with CSWS appear to learn by day and have that learning unwoven by nightly spike-wave activity. This is the original clinical framing.
  • Bölsterli 2011 (Clin Neurophysiol 122:1779–1787) — quantitative pre-remission anchor: overnight slow-wave downscaling (the Tononi-Cirelli fingerprint of synaptic homeostasis) is abolished during active ESES.
  • Bölsterli 2017 (Epilepsia 58:1892–1901) — quantitative post-remission anchor: the abolished downscaling renormalizes when ESES resolves.
  • Van den Munckhof 2020 (Sleep 43(11):zsaa088) — cognition link: the extent of slow-wave downscaling impairment correlates with severity of cognitive and behavioral compromise in individual children.
  • Tononi & Cirelli 2014 (Neuron 81:12–34) — theoretical backbone (Synaptic Homeostasis Hypothesis, SHY).

Implication for Levi: the UCSF-EEG clearance (2026-04-06–07) predicts that overnight consolidation should have resumed, which is precisely the substrate for the new-skill consolidation he is now showing (fork use, eye contact, recognition, nonverbal communication, possible language). This is not coincidence; it is the most parsimonious mechanistic explanation for the positive half of the mixed-valence picture.

New framing 2 — Thalamocortical sleep-spindle recovery as a cognition biomarker

A Chu-group arc, independent of but convergent with the Bölsterli / Van den Munckhof arc:

  • Kramer / Chu 2021 (J Neurosci 41(8):1816–1829) — focal sleep-spindle deficits anatomically co-localize with the epileptic focus and predict cognitive impairment in sleep-activated developmental epilepsy.
  • Stoyell / Chu 2021 (BMC Neurol 21:355) — case report: high-dose diazepam restored spindles the same night with accompanying cognitive improvement. Same-night restoration is mechanistically plausible and translationally meaningful.
  • Chu 2025 (Neurology 104(2):e210232) — already in corpus. Longitudinal thalamocortical spindle recovery arc.

Implication for Levi: follow-up sleep EEG with explicit spindle-quantification is a feasible biomarker of consolidation-capacity recovery. This is operationally actionable rather than just conceptually interesting.

New framing 3 — Cross-diagnostic neurorehabilitation layer for the negatives

This is the framing the prior version of this memo was weakest on. The "same returning drive that enables engagement also produces disinhibition" pattern has a robust, quantified literature in adult neurorehabilitation — not a perfect match for Levi's clinical setting, but the closest cross-diagnostic analogue:

  • Sherer 2020 (Arch Phys Med Rehabil 101:2041–2050) — ACRM formal case definition of Post-Traumatic Confusional State (PTCS). Defines the transitional phase after emergence from MCS in which returning engagement and disinhibition/agitation co-occur as two faces of the same recovery step.
  • Bodien & Giacino 2020 (NeuroRehabilitation 46:65–74) — eMCS-emergence literature cites agitation rates around 69% during that transitional phase.
  • Phyland, Ponsford et al. 2021 (J Neurotrauma 38:3047–3067) — meta-analysis: 31.73% pooled TBI agitation prevalence, 44% during post-traumatic amnesia. One in three overall, nearly half during active post-injury confusion. Agitation typically resolves with the underlying confusional state.
  • Wang 2021 (Frontiers in Surgery, PMC8097005) — reframes agitation as a clinical sign of recovery of consciousness, not a complication. (Mis-cited in the user-supplied report as "Lombard, Frontiers in Neurology"; see report-review memo.)

Implication for Levi: the new negatives (elopement, toilet-water play, mild aggression, toileting regression) are statistically expected — on the order of 30–70% — in the closest cross-diagnostic analogue, and they typically resolve as the underlying confusional/transitional phase resolves. This reframes hypothesis A (developmental-unmasking) rather than replacing it: both are operating, and the neurorehabilitation literature supplies the quantitative prior.

New framing 4 — Disinhibition-as-learning-engine (circuit-level backbone)

  • Letzkus, Wolff & Lüthi 2015 (Neuron 88:264–276) — cortical disinhibition via VIP→PV/SST circuits is a documented circuit-level mechanism for associative learning. The same plastic substrate that enables learning also increases susceptibility to impulsivity and stimulus-driven behavior.

Implication for Levi: the claim that "the same circuit change produces both the new learning and the new dysregulation" is not just clinical intuition. It has a circuit-level mechanism. Critically, this predicts that the disinhibition features should attenuate as executive modulation catches up to the plastic substrate, not persist indefinitely.

New framing 5 — Acquired epileptic frontal syndrome (historical-clinical grounding)

  • Roulet-Perez 1993 (Dev Med Child Neurol 35:661–674) — canonical early description of behavioral/frontal regression as part of the CSWS phenotype, not an incidental comorbidity.

Implication for Levi: the behavioral axis of Levi's pre-pulse phenotype, and the behavioral axis of the recovery, are both legitimately part of what CSWS does — consistent with how the family has been tracking it.

Revised mixed-valence interpretation

Folding the new framings into the four-hypothesis table:

  • Positive gains (fork use, eye contact, recognition, nonverbal communication, possible language): Hypothesis A (developmental unmasking) plus the sleep-homeostasis substrate (Bölsterli/Van den Munckhof/Tononi-Cirelli) plus the spindle-recovery substrate (Kramer/Stoyell/Chu). Three independent mechanistic layers now back the positive-gains interpretation.
  • Negative gains (elopement, toileting regression, mild aggression, toilet-water play): Hypothesis A (communication-mismatch elopement + developmental-age unmasking) plus the cross-diagnostic PTCS/eMCS-confusion framing (Sherer/Bodien-Giacino/Phyland/Wang) plus the circuit-level disinhibition-as-learning mechanism (Letzkus). Three independent framings now back the "expected recovery-phase feature" interpretation.
  • Forced-normalization (Landolt phenomenon) as a ruled-out construct: Krishnamoorthy & Trimble 1999 is the correct reference point; the phenotype (psychiatric-severity behavioral dysregulation replacing improved EEG with no matching new skills) does not match Levi's mixed-valence picture. Mixed valence with new positive skills argues against forced normalization.
  • Subclinical EEG relapse: still the least likely interpretation. Would predict loss of recently gained skills, not co-emergence of new gains.
  • Post-pulse / HPA aftermath: unchanged; covered in 2026-04-18-steroid-pulse-rebound-behavior.md and 2026-04-19-hpa-axis-evidence-synthesis.md.

Practical implication (unchanged direction, higher confidence)

  • Continue watchful, environmentally-structured management of the negative behaviors; do not reach for sedation that would suppress the very circuit state enabling the positive gains.
  • Track the trajectory weekly. The neurorehabilitation literature predicts attenuation of the negative features as the confusional/transitional phase resolves.
  • Consider follow-up sleep EEG with spindle quantification as a biomarker of consolidation-capacity recovery — now a concrete, evidence-backed option.
  • If the negative features intensify without continued positive gains over multiple weeks, the differential shifts toward subclinical EEG relapse or pure post-pulse aftermath and a repeat EEG becomes more urgent.

Added source papers from the 2026-04-19 report integration

  • content/research/papers/2009-tassinari-penelope-syndrome-csws.md
  • content/research/papers/2011-bolsterli-overnight-slow-wave-downscaling-impairment-eses.md
  • content/research/papers/2017-bolsterli-eses-remission-slow-wave-renormalization.md
  • content/research/papers/2020-vandenmunckhof-slow-wave-downscaling-cognition-csws.md
  • content/research/papers/2014-tononi-cirelli-synaptic-homeostasis-hypothesis.md
  • content/research/papers/2021-kramer-chu-focal-spindle-deficits-csws.md
  • content/research/papers/2021-stoyell-chu-diazepam-spindle-csws.md
  • content/research/papers/2020-sherer-ptcs-case-definition.md
  • content/research/papers/2020-bodien-giacino-emcs-confusion.md
  • content/research/papers/2021-phyland-ponsford-tbi-agitation-meta-analysis.md
  • content/research/papers/2021-wang-agitation-recovery-of-consciousness.md
  • content/research/papers/2015-letzkus-disinhibition-learning-neuron.md
  • content/research/papers/1993-roulet-perez-acquired-epileptic-frontal-syndrome.md
  • content/research/papers/2012-seegmuller-deonna-csws-long-term-outcome.md

Full source-verification audit is in content/research/notes/2026-04-19-report-review.md.

HPA Axis / Hypothalamic Dysfunction Evidence Synthesis - April 19, 2026

HPA-Axis and Hypothalamic-Dysfunction Evidence Synthesis

Purpose

Jake raised the hypothesis that Levi may have HPA-axis dysfunction, and separately contributed a durable phenotypic observation (recurrent nocturnal awakenings with stimmy hyperarousal and food-seeking, ~1.5-year history, gradual onset, predating the April 2024 regression and DEE-SWAS diagnosis). This memo synthesizes what the literature says about that hypothesis across four sub-questions, then gives an explicit likelihood assessment for Levi.

Primary evidence sources are cited inline and ingested as per-paper records under content/research/papers/ where they are of primary importance. Secondary citations are given by PubMed/DOI/URL only.


Question 1 - Is there a published connection between DEE-SWAS and HPA-axis / hypothalamic-pituitary dysfunction?

Yes, mechanistically. Evidence is moderate but specific.

The single most targeted citation is Kessi et al. 2019 (record; doi:10.33696/pharmacol.1.009), a mechanistic review of CSWS pathogenesis that explicitly implicates:

  1. Low growth hormone (GH) in affected children - ties CSWS to hypothalamic-pituitary somatotroph output and to the GHRH rhythm that normally declines with age.
  2. Low melatonin - pineal / suprachiasmatic-nucleus-driven circadian hormone reduced in CSWS, supporting a hypothalamic-circadian contribution to the NREM-specific spike-wave burden.
  3. Elevated IL-6 - linking CSWS to neuroinflammation and to steroid responsiveness via IL-6 suppression.

Kessi also proposes that steroids work in CSWS via (a) GABA-A enhancement, (b) IL-6 suppression, and (c) favoring REM over NREM (REM is seizure-free in CSWS because spike-wave activity is NREM-dependent). This reframes the dramatic response Levi showed to the March 2026 methylprednisolone pulse as partly an anti-inflammatory and partly a sleep-architectural effect.

The analogous pediatric example is Peng et al. 2020 (record; PMID 32805608), which argues that HPA-axis dysfunction is underrecognized in pediatric epileptic spasms (West syndrome / IESS), another developmental epileptic encephalopathy that responds dramatically to ACTH and glucocorticoids. The logic transfers: if a steroid-responsive pediatric DEE merits explicit HPA-axis characterization, DEE-SWAS does too.

General foundational evidence on sleep-HPA bidirectionality is well-established: Balbo et al. 2010 (record; 365+ citations) sets out that sleep onset inhibits cortisol, awakenings stimulate cortisol, and chronic sleep disturbance produces cumulative HPA activation. Pediatric data echo this: Saridjan 2017 (PMID 28570434) shows flatter diurnal cortisol slope and larger cortisol awakening response correlate with shorter sleep in preschoolers; Fernandez-Mendoza 2014 (PMID 24635035) shows insomnia-symptom children have elevated cortisol; Ozcelik 2023 (PMID 36939684) shows children with epilepsy have shorter sleep, evening chronotypes, and more arousal/sleep-wake-transition disorders than controls.

Strength of evidence for DEE-SWAS ↔ HPA specifically: moderate. Kessi 2019 is the clearest single source; it is a short mechanistic communication, not a cohort study. There is no published case-control study that has systematically characterized AM cortisol, ACTH, IGF-1, prolactin, or diurnal cortisol in DEE-SWAS / CSWS patients. That gap is itself an argument for ordering the tests in Levi.


Question 2 - Do Levi's hypothesized root causes have endocrine / HPA implications?

Yes, several of them - and the HPA question therefore overlaps with the differential rather than competing with it.

Going theory-by-theory through content/differential/etiologies.yaml:

overgrowth-pi3k-akt-mtor-axis (rank 1) and overgrowth-mosaic-mtor-pathway (rank 2)

Direct overlap. The PI3K-AKT-mTOR pathway is a canonical regulator of growth, metabolism, and glucose homeostasis:

  • Hypoglycemia is a recognized feature of PI3K-AKT-mTOR pathway defects. Maines et al. 2021 (record; PMID 33876391) describes recurrent hypoglycemia in PTEN and PPP2R5D patients with macrocephaly, and argues these pathway defects should be on the differential of pediatric hypoglycemia + macrocephaly.
  • Hypothalamic PI3K-mTOR signaling is a critical node in insulin-induced sympathetic activation (Muta 2013 HYPERTENSION Abstract 35), connecting pathway dysregulation to autonomic features.
  • Pituitary involvement is established: mTOR hyperactivity drives pituitary tumor formation in animal models (Chen 2017 Oncogene, PMID 27524416); pituitary knockout of Tsc1 or Pten causes prolactinoma.
  • Epilepsy from PTEN loss is driven by dual mTORC1 + mTORC2 hyperactivity (Cullen 2023, PMID 38446016), which is relevant to mTOR-directed therapy if a mosaic variant is ever confirmed.

Transfer to Levi: if an mTOR-pathway mosaic variant is identified, recurrent occult nocturnal hypoglycemia is in the expected spectrum; IGF-1/IGF-BP3 and fasting glucose are indicated as part of the workup regardless of whether the HPA theory is right.

overgrowth-sotos-weaver-epigenetic (rank 3)

Some overlap. Sotos syndrome is not driven by classical GH excess (Visser 2005, PMID 15362962; GeneReviews NBK1479) - IGF-1 and GH secretion are typically normal, though paracrine IGF-system alterations exist. However, Sotos is specifically associated with:

  • Congenital hypothyroidism in some cases (PMC8319649)
  • Hyperinsulinemic hypoglycemia in a subset (Grand 2019, reported in GeneReviews)
  • Neonatal hypoglycemia as a recognized feature

Weaver syndrome (EZH2) and related chromatinopathies have less-characterized endocrine profiles but share developmental overlap.

Transfer to Levi: IGF-1 and stimulated GH tests are more likely to be in the normal-to-low range than elevated, even if Sotos were the answer. Glucose homeostasis remains relevant.

overgrowth-dnmt3a-tbrs (rank 4)

Targeted overlap. Hage et al. 2019 (record; PMID 31858400) reports a GH-secreting pituitary macroadenoma in a genetically confirmed TBRS patient, establishing that pituitary involvement is part of the TBRS spectrum. Jimenez 2023 (PMID 37795572) documents a TBRS-specific neuroimaging signature (corpus callosum anomalies, small posterior fossa, deep left Sylvian fissure, increased cortical thickness).

Transfer to Levi: IGF-1 as a screen for GH excess is specifically motivated. Dedicated sellar MRI re-read is also warranted if the TBRS theory stays live.

overgrowth-bws-11p15 (Beckwith-Wiedemann Spectrum)

Some overlap. BWS is a canonical cause of neonatal and persistent hyperinsulinemic hypoglycemia (GeneReviews NBK1394). This is relevant to the differential even though no neonatal hypoglycemia is documented for Levi.

seronegative-cell-mediated-neuroinflammation (rank 5)

Moderate overlap via IL-6 and cytokine-HPA loops. Kessi 2019 connects elevated IL-6 to CSWS pathogenesis. IL-6 is a canonical HPA-axis activator (Papanicolaou 1998 PMID 9534937). If serum or CSF IL-6 is elevated in Levi (pending), the HPA theory and the neuroinflammation theory converge rather than compete.

iron-deficiency-amplifier (rank 6)

Indirect overlap. Iron deficiency independently affects sleep architecture and dopaminergic function, which interact with HPA-axis regulation. Addressing iron repletion is already a rank-2 treatment and does not wait on the HPA workup.

post-infectious-trigger-jan-2026 (rank 7)

Limited direct overlap. Post-infectious / parainfectious mechanisms could transiently disturb HPA function via cytokine-mediated effects, but this is a weak link compared with the other theories.

classical-autoimmune-encephalitis (rank 8, less_likely)

No specific HPA overlap expected.

mitochondrial-primary (rank 9, unlikely)

Some overlap - mitochondrial disorders can affect hypothalamic energy sensing and endocrine function, but this theory is already low-ranked.

classical-ieom (rank 10, unlikely)

Overlap depends on the specific IEM. Some IEMs (carnitine defects, fatty acid oxidation defects) can cause nocturnal hypoglycemia. Already covered by newborn screen.

gut-microbiome-driver (rank 11, less_likely) and structural-vascular-perinatal (rank 12, less_likely)

Minimal direct overlap.

Summary of theory-by-theory endocrine overlap

The HPA-axis / hypothalamic-dysfunction question is not orthogonal to the existing differential - it is a cross-cutting axis that meaningfully intersects the top four theories (PI3K-AKT-mTOR germline, PI3K-AKT-mTOR mosaic, Sotos/epigenetic, TBRS/DNMT3A) and the neuroinflammation theory. Characterizing the axis is therefore informative across multiple competing theories simultaneously.


Question 3 - What is the diagnostic workup for suspected pediatric HPA-axis / hypothalamic dysfunction?

A formal pediatric scoring system exists. van Santen et al. 2023 (record; PMID 36737045) defines 9 domains that together constitute a hypothalamic-syndrome diagnosis: hyperphagia, hypophagia, BMI, behavioral problems, sleep disorders, temperature regulation, pituitary dysfunction, radiological hypothalamic assessment, and presence/suspicion of a hypothalamic genetic syndrome. Applying this to Levi:

DomainStatus in LeviEvidence
HyperphagiaPresent; now with nocturnal / circadian-patterned componentPhenotype addendum
HypophagiaAbsentApril 9 profile
BMI99th percentile for weight; BMI per age not formally calculatedApril 9 profile + growth curves
Behavioral problems (OCD / hoarding / rage)Partial - autism-spectrum behaviors but not clearly the van Santen OCD/hoarding/rage phenotypeApril 9 profile
Sleep disordersPresent - recurrent nocturnal awakenings, disrupted sleepPhenotype addendum
Temperature regulationPresent - temperature instabilityApril 9 profile
Pituitary dysfunctionUntested - only TSH, fT3, fT4, TPO, Tg Abs have ever been drawncontent/vault/indexes/test-results.yaml
Radiological hypothalamic assessmentUntested - April 2026 MRI did not use a dedicated sellar/hypothalamic protocolcontent/vault/records/2026-04-07-imaging-ucsf-brain-mri-full-report.md
Genetic hypothalamic syndromeUnresolved - differential includes mosaic PI3K-AKT-mTOR, TBRS, BWS, ROHHAD not genetically definedcontent/differential/etiologies.yaml

Levi presents with at least 3 domains likely scored as present (hyperphagia, sleep disorder, temperature regulation) and 2 additional domains untested rather than negative (pituitary dysfunction, radiological assessment). This is sufficient to warrant a structured hypothalamic / HPA-axis workup.

Recommended pediatric probe order

  1. Morning cortisol (8 AM) + ACTH - single baseline draw. Pediatric thresholds: <150 nmol/L (5 μg/dL) suggests AI; ≥317 nmol/L (8.6 μg/dL) strongly suggests recovered/normal axis; intermediate values warrant LD-SST (Improda 2024; Drummond 2020, PMID 32959333).
  2. Diurnal salivary cortisol (4-point: waking, +30 min, afternoon, bedtime) - higher-value probe than single AM draw for Levi because the nocturnal-arousal phenotype suggests rhythm disturbance, not necessarily absolute deficiency. Characterizes the shape of the curve.
  3. IGF-1, IGF-BP3, prolactin - screen anterior-pituitary somatotroph and lactotroph output. IGF-1 doubles as a screen for GH excess (TBRS; Hage 2019) and GH deficiency (CSWS low-GH signal; Kessi 2019).
  4. Fasting leptin (and insulin if tolerated) - relevant to hypothalamic-hyperphagia phenotypes (PWS, MC4R-pathway, leptin/POMC-axis disorders, ciliopathies).
  5. Structured 2-week sleep diary and/or actigraphy - characterizes the circadian pattern without any blood draw; provides baseline for any future intervention.
  6. Dedicated sellar / hypothalamic MRI re-read - add to the already-planned specialized neuroradiology re-read of the April 2026 study.
  7. Low-dose Synacthen test (LD-SST, 1 μg) - if AM cortisol is equivocal (150-317 nmol/L range) or if diurnal salivary shows a flat curve. Cortisol measured at baseline, 30 min (not only 20 min; single-timepoint 20-min sampling overdiagnoses AI in pediatrics).
  8. Overnight EEG correlation - at the next overnight EEG, pre-specify annotation of any nocturnal arousal to separate epileptiform-driven from endocrine-driven awakening. This is cheap and highly informative.
  9. Opportunistic critical-sample capture during a nocturnal awakening (glucose + cortisol + insulin + GH) - lower priority given non-distressed awakening character, but worth capturing if an awakening occurs during an admission or sleep study.
  10. Water-balance evaluation (serum sodium, serum + urine osmolality, ADH status) - if posterior-pituitary involvement is suspected clinically.

Timing consideration: recent steroid pulse

Levi received a 3-day IV methylprednisolone pulse in March 2026. Per Improda 2024 and the 2024 ESE/Endocrine Society guideline, brief pulses rarely cause sustained HPA suppression, and most pediatric patients recover within 4-10 weeks. By April 19, 2026 Levi is >4 weeks post-pulse, so a morning cortisol now is interpretable. But if chronic oral prednisolone or repeated pulses are contemplated per the steroid-sparing-immunomodulation-if-relapse item, a baseline cortisol/ACTH before any additional steroid exposure is the prudent ordering sequence.


Question 4 - Treatments including lifestyle and nutrition (pre-bedtime snack)

Treatments split into three buckets: lifestyle/nutrition (low-risk, empiric, low cost); targeted (dependent on workup findings); and contingent (only if specific deficits are documented).

Lifestyle / nutrition (empiric, low-risk)

Pre-bedtime snack with complex carbohydrate + protein and/or healthy fat. Evidence base is strongest from the pediatric diabetes literature (DirecNet, PMC2593894; Desjardins 2014 PMID 25451901) but the mechanism - preventing nocturnal glucose drop that triggers adrenergic/cortisol counter-regulation - is independent of whether Levi has diabetes. Specific practical points:

  • Compose: complex carbohydrate (whole grain, legumes, fruit) + protein (Greek yogurt, nut butter, cheese, egg) + a small amount of fat. Avoid pure simple sugar loads (candy, sweet pastries, white bread), which produce glucose spikes followed by crashes that trigger cortisol/adrenaline release and wake the child (MDPI 2025, Feeding the Rhythm).
  • Timing: 30-60 minutes before sleep onset. Protein/carb co-ingestion 3-4 hours before sleep maximizes melatonin/tryptophan benefit but is often impractical; closer-to-bedtime is more relevant for glucose stabilization.
  • Expected benefit in Levi: reduces probability of a glucose-counter-regulation-driven arousal, stabilizes overnight cortisol rhythm, adds melatonin/tryptophan substrate. Low-cost experiment, low-risk, interpretable over 2-4 weeks with a simple sleep diary.

Sleep hygiene and a consistent sleep-wake schedule. Foundational for any circadian/HPA intervention. Pair with a 2-week actigraphy baseline so any change is measurable.

Empiric bedtime melatonin (after neurology-team discussion). Kessi 2019 documents low melatonin in CSWS; melatonin is a safe, widely used pediatric sleep intervention with modest but measurable effect on sleep-onset latency and consolidation. Not first-line for a nocturnal-awakening phenotype (vs. sleep-onset insomnia) but worth discussing given the documented low-melatonin signal in CSWS.

Targeted / workup-dependent

If AM cortisol or LD-SST confirms adrenal insufficiency: physiologic hydrocortisone replacement per pediatric endocrinology, plus stress-dose coverage for illness/surgery. Follow Improda 2024 pediatric thresholds.

If central hypothyroidism, central hypogonadism, GH deficiency, or diabetes insipidus is documented: corresponding replacement per pediatric endocrinology.

If IGF-1 is elevated (GH excess pattern): dedicated sellar MRI, OGTT-GH suppression test, pediatric neuroendocrine referral.

If leptin is abnormal: evaluate for monogenic hypothalamic-hyperphagia phenotypes (MC4R-pathway, POMC-axis) and for hypothalamic-obesity syndromes.

Contingent / downstream

If repeated steroid pulses or chronic oral prednisolone become the plan per the steroid-sparing-immunomodulation-if-relapse treatment item: establish baseline cortisol before starting; monitor morning cortisol between pulses; stress-dose policy during intercurrent illness. This is a pure safety update to the existing treatment framing, not a new treatment.

If the workup surfaces ROHHAD-adjacent hypothalamic dysfunction with documented central hypoventilation: polysomnography with end-tidal/transcutaneous CO2 monitoring, thoracoabdominal imaging for neural crest tumor screen, and multidisciplinary ROHHAD-center referral (Lazea 2021).

What NOT to do empirically

  • Do not empirically prescribe glucocorticoids for an HPA-axis theory without documented adrenal insufficiency. Exogenous steroids would confound any future axis characterization.
  • Do not empirically prescribe GH without documented GH deficiency on stimulation testing. Not indicated in a child on the 99th percentile for height.
  • Do not assume a normal morning cortisol rules out rhythm disturbance. The literature is clear that flattened diurnal slope is a distinct abnormality from low AM cortisol.

Question 5 - Overall likelihood Levi is experiencing HPA-axis or hypothalamic-axis issues

Synthesizing across Questions 1-4.

What would a "hypothalamic / HPA-axis contribution" mean, precisely

This hypothesis is not a single claim. It is a family of related claims of varying strength:

Sub-hypothesisOperational definitionCurrent likelihood estimate
A. Broad hypothalamic involvementLevi meets ≥3 van Santen domains with ≥1 pituitary-axis abnormality or imaging signalModerate-to-high (40-60%). Already meets 3 phenotypic domains; pituitary testing not yet done; imaging re-read pending.
B. Primary adrenal / central adrenal insufficiencyDocumented low AM cortisol + inadequate stimulation responseLow (5-15%). Overgrowth, normal electrolytes, and non-distressed nocturnal awakening argue against frank AI. Still worth testing because it's cheap and consequential if present.
C. Diurnal cortisol rhythm disturbanceFlattened slope or phase-shifted curve on 4-point salivary cortisolModerate (30-45%). Recurrent 1.5-year nocturnal awakenings in the cortisol-rise window predict this on first principles; general pediatric evidence (Saridjan 2017, Balbo 2010) supports bidirectional sleep-HPA coupling.
D. Somatotroph (GH/IGF-1) axis abnormalityIGF-1 outside age-specific reference range; OR deficient stimulated GH responseLow-to-moderate (15-30%). Kessi 2019 documents low GH in CSWS; Levi's overgrowth makes frank GH deficiency unlikely clinically; but paracrine IGF alterations (Sotos) or pulsatile abnormalities are possible.
E. Posterior pituitary / water balance abnormalityAbnormal serum sodium, abnormal water-deprivation response, elevated copeptinLow (<10%). No documented polyuria/polydipsia/hyponatremia.
F. Thyroid axis abnormalityTSH or fT4 outside referenceVery low (<5%). Tested twice and normal.
G. Hypothalamic hyperphagia / leptin-MC4R-POMC axisAbnormal fasting leptin; monogenic hypothalamic-obesity genotypeLow-to-moderate (15-25%). Calm nocturnal food-seeking after 1.5 years fits the phenotype; no prior testing.
H. ROHHAD specificallyMeets Ize-Ludlow criteria (rapid-onset obesity + central hypoventilation + autonomic + endocrine)Low (<10%). No rapid-onset obesity, no documented hypoventilation; overgrowth pattern is wrong shape. But workup overlap is substantial.
I. Circadian-phase disruption (SCN-driven, not strictly HPA)Phase-advanced / fragmented sleep on actigraphyModerate-to-high (40-60%). Recurrent circadian-clustered arousals fit; actigraphy never done.

Aggregate read

  • The strong claim ("Levi has primary endocrine failure driving DEE-SWAS") is unlikely in the specific sense of frank adrenal or pituitary insufficiency.
  • The moderate claim ("Levi has hypothalamic / circadian-system involvement that contributes to sleep disruption and to the hyperphagia / temperature / pain threshold cluster, with possible cortisol-rhythm or IGF-axis perturbation") is moderately likely (~40-60%) and motivates specific, cheap, high-yield tests.
  • The weak claim ("Characterizing Levi's HPA and hypothalamic axis would change management decisions by either widening or narrowing the differential") is very likely (~80-90%) because several top differential theories (mTOR-pathway, TBRS, Sotos, BWS, neuroinflammation) have endocrine overlaps and because the documented nocturnal-arousal phenotype is independently important regardless of etiology.

Recommended action

Do the workup. Specifically and in order:

  1. Morning cortisol + ACTH + IGF-1 + IGF-BP3 + prolactin + fasting leptin - single draw, low cost, high information density.
  2. 4-point diurnal salivary cortisol over 1-2 collection days.
  3. 2-week sleep diary (free) and/or actigraphy if the clinical team has access.
  4. Request a dedicated sellar / hypothalamic-protocol read on the April 2026 MRI.
  5. Pre-specify nocturnal-arousal annotation on the next overnight EEG.
  6. Empiric pre-bedtime complex-carb + protein snack - low-risk, independently sensible, gives a 2-4 week look at whether it reduces awakening frequency.
  7. Re-review once results are in; at that point either (a) escalate to LD-SST and/or dedicated pediatric endocrinology evaluation, or (b) formally move the hypothalamic/HPA theory from "plausible untested" to "screened negative."

Provenance and research pass

  • Literature pass run 2026-04-19 on branch agent/2026-04-19-hpa-axis-investigation.
  • Elicit sync searches executed against DEE-SWAS / CSWS / pediatric epilepsy × HPA, overgrowth × endocrine, ROHHAD, steroid-induced adrenal insufficiency, and bedtime snack / cortisol.
  • Claude web research used for hypothalamic-dysfunction pediatric diagnostic criteria, bedtime snack and cortisol rhythm, Sotos endocrine features, and methylprednisolone pulse adrenal recovery.
  • Async Elicit report breadcrumb at content/research/elicit-reports.yaml (report id 5afd8859-b185-456f-b9ab-cf3d1e77e4b9, status was still processing at pass close).
  • Six new per-paper records were ingested under content/research/papers/ (Kessi 2019, Peng 2020, van Santen 2023, Improda 2024, Maines 2021, Hage 2019, Lazea 2021, Balbo 2010).
  • This memo, the per-paper records, the nocturnal-hyperphagia phenotype addendum, and the differential/diagnostics/treatments/case-overview updates are intended to be reviewed together as one PR.
Individual patient stories similar to Levi's case (CSWS/ESES/LKS/DEE-SWAS) — scored survey (2026-04-19)

Individual patient stories similar to Levi's case — scored survey (2026-04-19)

Trigger

On 2026-04-19 Jake asked for named, findable stories of specific individual children whose trajectory resembles Levi's — not aggregate outcome data. The ideal match is a child who (1) developed normally through ~2–3 years, (2) began a gradual, multi-year regression rather than a sudden overnight loss, (3) did not have clinically obvious seizures, (4) was diagnosed with CSWS / ESES / LKS / DEE-SWAS relatively late (around age 5+) after a long diagnostic delay, often carrying an autism diagnosis first, and (5) had a documented treatment response (steroids, IVIG, benzodiazepines, ACTH) with a post-treatment trajectory described.

Categorically excluded up front: Sotos / NSD1 stories; classic early-onset LKS with overnight aphasia and obvious seizures diagnosed quickly; infantile epileptic encephalopathies (Dravet, West, LGS); autism regression with no EEG component; defined monogenic syndromes (Rett, Angelman, Fragile X) unless the narrative specifically mirrors Levi's; and pure cohort statistics without an individual narrative.

Scoring rubric

Each candidate was scored 0–100 using the rubric from Jake's brief:

DimensionWeight
Regression onset age (closer to 2–3)20
Gradual regression tempo over months/years15
No clinical seizures15
Late CSWS/ESES/LKS diagnosis with long delay15
Autism diagnosed first10
Treatment response described10
Overgrowth / negative genetics / mosaic bonus5
Story quality / verifiability10

Reject threshold: <50. Stories between 50 and 69 are listed as runners-up. Categorically-excluded stories I found and deliberately filtered are listed at the end so Jake can see what I looked at and ruled out.

Candidate pool (15+ stories reviewed; see Addenda 1–3 for post-initial additions)

The search reached real parent-authored accounts and foundation/news patient spotlights. Reddit, specifically, was not richly indexed for these rare-disease terms by the search tool — most "Reddit" queries returned no results, so the Reddit/Facebook layer below is underrepresented and would benefit from direct in-platform searching by a human. The stories below come from: Complex Child magazine (parent-authored), The ASHA Leader (professional-outlet case study), Epilepsy Ontario (mother profile), Action Medical Research (UK charity family stories), Hands & Voices (parent newsletter), FamilieSCN2A Foundation (parent-founded foundation), Boston Children's Hospital patient spotlight, Edmond Outlook and City Sentinel (local Oklahoma news), Trilogy Publishing (parent-authored book), Mayo Clinic Connect (parent forum), and deepconnections.net (parent-hosted webinar summary).

Top 5 closest matches


Story 1 — Joshua (Complex Child magazine) — similarity: 72/100

Source: Vinez Campbell, "Seizures During Sleep: One Boy's Journey with CSWS Epilepsy," Complex Child, November 2016. https://complexchild.org/articles/2016-articles/november/csws-epilepsy/ (the original site now appears to be taken down, but the text is extensively cached and quoted in multiple secondary sources including Epsy Health and several clinical-literacy blog posts.) Parent-authored.

One-line summary: Normally-developing boy who, starting around age 4, developed social/anxiety/language regression with autism-like features and no overt seizures, was eventually diagnosed with CSWS on prolonged EEG, and had autism-like symptoms resolve on low-dose nighttime clobazam.

Timeline:

  • Born 2010. Early development normal by mother's account.
  • ~Age 4: "Joshua began declining in social skills, becoming anxious, withdrawn, and easily angered; he exhibited signs of autism, developed a fluctuating stutter, had difficulty finding words, often refused to answer when spoken to, and became increasingly uncooperative."
  • Referred to a developmental pediatrician who witnessed one brief staring spell and ordered an EEG.
  • Initial EEG read as Benign Rolandic Epilepsy; further neurological workup with a multi-night hospital EEG documented near-continuous spike-wave activity during 85% of sleep across 5 nights.
  • Diagnosed with CSWS at age 6 (per the mother's "he is six years old" framing of the article).
  • Treated with low-dose nighttime Onfi (clobazam).
  • Post-treatment: "Within a few months of starting his new medication regimen, the ESES pattern on the EEG disappeared, Joshua's speech improved, he began experiencing an explosion of learning, and the autism-like symptoms resolved. He has less seizures and his behavior has improved dramatically. He is currently doing well in a mainstream classroom with the assistance of a personal aide."

Why this is close to Levi's case:

  • Regression began at an age adjacent to Levi's (~4 vs. Levi's ~2.5).
  • Regression was gradual and multi-domain (social withdrawal, word-finding, anxiety, autism-like features) rather than overnight aphasia.
  • No clinically obvious seizures before EEG — only one brief staring spell was the trigger.
  • Regression had autism-like presentation that resolved with CSWS-directed treatment — exactly the phenotype shift Jake is watching for.
  • Treatment response described in detail.

Why it's not a perfect match:

  • Regression onset at ~4 rather than ~2.5 — about a year later than Levi.
  • Joshua had a first seizure at 10 weeks of age (described as an isolated event), which Levi never had.
  • Treatment was low-dose clobazam, not a steroid pulse.
  • Diagnostic delay was ~2 years (4→6), shorter than Levi's ~3 years.

What I can learn from this family's experience:

  • The "autism-like symptoms resolved" framing is real in CSWS literature and is the best-case post-suppression trajectory to hope for.
  • Low-dose nighttime benzodiazepine monotherapy can be sufficient in some children and spares the steroid side-effect profile — worth knowing as a fallback if steroid durability wanes.
  • A single brief staring spell was the clinical key that unlocked the diagnosis. The message is that an EEG capturing NREM sleep must happen even when clinical seizures are essentially absent.

Verifiability notes: Named family (Vinez Campbell, son Joshua). Dated 2016. Complex Child magazine is (was) an established disability-family publication. The site is currently offline, but the text is extensively preserved in secondary sources.


Story 2 — Jennifer Young's son (Epilepsy Ontario) — similarity: 66/100

Source: "Mother underscores importance of diagnosing ESES epilepsy early," Epilepsy Ontario. https://epilepsyontario.org/mother-underscores-importance-of-diagnosing-eses-epilepsy-early/ — parent-named foundation profile.

One-line summary: Previously-typical Grade 2 boy with sudden academic and behavioral decline plus sensory sensitivities and no visible seizures; diagnosed with ESES on sleep-deprived EEG at age 7; treated immediately; dramatic recovery by age 9.

Timeline:

  • Previously typical development; performing well in Grade 1.
  • Age 7 (Grade 2): sudden academic decline, new behavioral changes, sensory sensitivities (couldn't tolerate clothing, gloves in winter).
  • "There was no visible indication her son had been having seizures" — mother and doctors both flagged the presentation as "psychological."
  • Family physician ordered an MRI (normal) and EEG (abnormal); referred to McMaster University Medical Centre; sleep-deprived EEG confirmed ESES.
  • "They had him on treatment right away" (medication not specified in the profile).
  • By age 9: playing baseball, good peer relationships, improved schoolwork. Mother: "It was unbelievable to get our son back."

Why this is close to Levi's case:

  • No clinical seizures at any point — the pattern Levi has.
  • The presenting symptoms were cognitive and behavioral, not seizure-like — mirrors Levi.
  • Mother advocated for further testing when the story "felt psychological."
  • Treatment response was robust and life-changing.

Why it's not a perfect match:

  • Onset at age 7 is older than Levi's ~2.5.
  • Described as a "very sudden change" over the school year, not a slow-rolling multi-year regression.
  • Short diagnostic delay (<1 year), whereas Levi's was ~3 years.
  • Autism was never part of the presentation.

What I can learn from this family's experience:

  • The "it doesn't look like a seizure, it looks psychological" pattern is common and can stall the diagnostic workup for months. Persistent parental advocacy was the thing that got the EEG ordered.
  • A sleep-deprived routine EEG — not a multi-day video EEG — was sufficient to capture the ESES pattern in this child. Reasonable fallback if getting a long EMU slot is hard.
  • "Unbelievable to get our son back" is a real outcome when diagnosis and treatment happen together in the same visit. That framing is the emotional template for what success looks like.

Verifiability notes: Named mother (Jennifer Young). Named institution (McMaster). No surname given for the child. No dates of original diagnosis given, but the profile is hosted on a respected provincial charity.


Story 3 — Francesco (Action Medical Research, UK) — similarity: 64/100

Source: "Francesco's story," Action Medical Research. https://action.org.uk/research/family-stories/francescos-story — UK-charity patient spotlight with direct parent quotes from father Mathias.

One-line summary: Bilingual boy with previously normal development whose regression eventually diagnosed as LKS at Great Ormond Street Hospital; on twice-weekly pulsed steroids at age 5; learning to speak again (English only, has lost the bilingual second language); now "functionally deaf" because his brain does not process sound normally.

Timeline (reconstructed from the Action Medical Research profile and related NORD FOLKS overview):

  • Previously typical, bilingual development.
  • Regression brought Francesco to medical attention; multiple tests normal.
  • Referred to Great Ormond Street Hospital (specialist center); diagnosed with LKS.
  • At profile publication, age 5, on steroids and other medicines twice a week.
  • Post-treatment: "Francesco is learning to speak again, which is wonderful. However, previously bilingual, Francesco is now talking only in English."
  • Residual: "functionally deaf" because his brain does not process sounds in the right way; attends a school for deaf children; uses sign language; much more anxious than before. Music therapy described as calming.

Why this is close to Levi's case:

  • Multiple normal tests before the EEG-driven diagnosis — the "everyone kept telling us we were fine" pattern Jake and Miki know well.
  • Twice-weekly pulsed steroid regimen is the exact maintenance model Great Ormond Street has published on — directly relevant to Levi's current steroid-pulse-durability question.
  • Partial recovery with residual language impact and sensory-processing consequences (functional deafness) — honest about what steroid-era recovery actually looks like when the diagnosis comes late.
  • Age at profile (5) is exactly Levi's current age.

Why it's not a perfect match:

  • The profile does not specify the age at regression onset or whether he had overt seizures, so the diagnostic delay and seizure phenotype are both unclear.
  • Autism was never the first label.
  • The bilingual-loss detail and specifically-language regression (vs. global) put this closer to classic LKS than to Levi's global trajectory.

What I can learn from this family's experience:

  • Twice-weekly pulsed steroid dosing is the Great Ormond Street long-term strategy and is directly actionable for Levi's next conversation with neurology about maintaining the pulse response.
  • Recovery is not all-or-nothing. Language can return but an earlier-acquired second language can be lost permanently. Sensory processing (functional deafness) can remain.
  • Sign language and music therapy are scaffolds that helped a real child during the language-recovery window — worth considering during Levi's current electrographic-suppression window.

Verifiability notes: Named child (Francesco), named father (Mathias), named institution (GOSH), UK-registered charity. No surname given.


Story 4 — Dillon (The ASHA Leader) — similarity: 62/100

Source: Paul G. LaPorte and Patrick Conlon, "Identification and Treatment of Landau-Kleffner Syndrome," The ASHA Leader, Nov 2010. https://leader.pubs.asha.org/doi/10.1044/leader.FTR3.15112010.34 — speech-language pathology professional publication with a detailed individual case study.

One-line summary: Previously-typical boy whose nursery school teachers noticed he "wasn't responding as expected" at age 3.5; hearing evaluation normal; concerns continued for a full year before a severe language regression at ~4.5 triggered the LKS diagnosis.

Timeline:

  • Previously typical, bright child with normal language development.
  • Age 3.5: nursery school teachers report to parents that he is not responding as expected.
  • Hearing evaluation: normal. Deafness workup was a detour.
  • Age 3.5 to 4.5: teachers' concerns continue; no diagnosis.
  • ~Age 4.5: severe regression in language functioning → diagnosed with LKS.
  • Treatment and outcome details are not fully specified in the ASHA Leader article excerpt available.

Why this is close to Levi's case:

  • The full-year diagnostic delay with teacher concerns brushed off is the Levi pattern.
  • Auditory processing-looking presentation (doesn't respond to name) with normal hearing eval is the Levi pattern.
  • Age at final diagnosis (~4.5) is close to Levi's (5.5).
  • Starts with a pre-speech concern and escalates into language regression.

Why it's not a perfect match:

  • The article is a professional case write-up, not a parent-authored narrative, so some lived-experience texture is missing.
  • Onset at 3.5 is older than Levi's 2.5.
  • Treatment and post-treatment trajectory are not fully reported in the accessible portion.
  • No mention of autism diagnosis preceding LKS.

What I can learn from this family's experience:

  • School-based observers (nursery and kindergarten teachers) are often the first to see something off. Their documentation can be critical years later.
  • A normal hearing test does not close the loop. If the child still "isn't responding," keep pushing for a sleep EEG.
  • Dillon's case is literally what a published SLP journal holds up as the archetype of LKS missed for a year. It's the one to cite when advocating for earlier neurology referral in any similar child.

Verifiability notes: Published case study in the flagship publication of the American Speech-Language-Hearing Association. Child's name (Dillon) is published; surname withheld.


Story 5 — The Hands & Voices daughter (New Mexico) — similarity: 58/100

Source: "Landau-Kleffner Syndrome: Where do we fit in?", Hands & Voices (Vol 8, Issue 2). https://www.handsandvoices.org/articles/fam_perspectives/V8-2_landaukleffner.htm — parent-authored family-perspectives column.

One-line summary: Previously-typical girl with a vocabulary explosion by 10 months who then, over a single month at age 2, lost all language, appeared deaf, and had ~30 observable seizures per hour; diagnosed with LKS quickly; then followed over years through speech, sign, and Deaf-school education.

Timeline:

  • 8 months: first words ("da-da").
  • 10 months: vocabulary burst ("kitty," "thank you").
  • Age 2: losing vocabulary; "little eye blinks."
  • Within one month: unable to speak, appears deaf, 30 seizures/hour.
  • Pediatrician suspects seizures → EEG → referral to early childhood program → 24-hour video EEG confirms LKS.
  • Treatments: sign language, occupational therapy, speech therapy, seizure management.
  • At age 4.5 (2.5 years post-onset): attends New Mexico School for the Deaf preschool; academically engaged, socially thriving; verbal speech recovery "remains uncertain."

Why this is close to Levi's case:

  • Parent-authored with dates and quotes.
  • Parent-level honesty about uncertain long-term verbal outcome — rarer than it should be.
  • The "appears deaf / appears autistic / actually has LKS" confusion is explicitly narrated.

Why it's not a perfect match:

  • Onset at 2 is close to Levi's, but the tempo is very different — one month, not 2–3 years.
  • 30 observable seizures per hour — Levi has never had clinical seizures.
  • Fast diagnosis (same month), not a long delay.
  • Female patient (minor, but Levi's case notes are all male cohorts).

What I can learn from this family's experience:

  • When long-term verbal recovery is uncertain, the family's reframe toward a Deaf-education environment and sign-language fluency is instructive — it takes the pressure off "return of speech" as the only success outcome.
  • The mother's recounting of how the early-intervention clinicians, not the neurologists, first said the word "LKS" matters: it's a reminder that early-intervention teams see LKS often enough to recognize it even when more specialized providers miss it.

Verifiability notes: Parent-authored. Published in a recognized parent newsletter for families navigating deafness. No child's name given.


Addendum (2026-04-19 PM) — additional verified cases from peer-AI reports

Jake supplied two additional AI-generated research reports for cross-check. I re-verified each candidate against primary sources before adding. The following are newly verified high-scoring cases not found in my initial sweep — each deserves a place alongside or above the original top 5. I'm appending them here rather than renumbering the original top-5 so the lineage is preserved; when reading the full list of closest matches, treat these and the original top-5 as a combined pool.


Story A — Symonds siblings (index boy + older brother + older sister, Glasgow) — similarity: 88/100 each

Source: Symonds J, Zuberi S, Wilson M, Bumke K, Dorris L, Cobbs G. "A Family with Steroid-responsive Autism." Scottish Paediatric Society St Andrew's Day Paediatric Symposium, Edinburgh, 27 Nov 2015. Abstract in Scottish Medical Journal. DOI 10.1177/0036933016639797 · Repository record: Glasgow Enlighten. Peer-reviewed conference abstract from the pediatric neurology group at the Royal Hospital for Sick Children, Glasgow (Sameer Zuberi is one of the leading CSWS/ESES clinicians in the UK).

One-line summary: A family of three siblings — two older children carried "autism" diagnoses for years with no suspicion of epilepsy until the youngest presented with a first convulsive seizure at age 5, prompting an EEG that showed ESES; the two previously-autism-labeled older siblings were then also EEG-tested, also had ESES, and all three responded to oral prednisolone with improvements in language and behavior.

Timeline (older brother):

  • Normal development; gained language skills.
  • Age 2–4: gradual regression in speech and behavior.
  • Age 4: diagnosed with autism spectrum disorder.
  • Age 9: EEG testing prompted by his younger brother's seizure and ESES diagnosis. His EEG showed ESES. No clinical seizures ever observed. 5-year gap between autism diagnosis and ESES discovery.
  • Treatment: oral prednisolone.
  • Outcome: significant language and behavioral gains, progressed to 3–4 word sentences.

Timeline (older sister):

  • Normal development; could say names, colors, sing songs.
  • Age 2–5: lost all expressive language.
  • Age 5: diagnosed with autism spectrum disorder.
  • Age 7: EEG testing (same trigger) confirmed ESES. No clinical seizures ever observed.
  • Treatment: oral prednisolone.
  • Outcome: began speaking again, starting with her brothers' names.

Why this is close to Levi's case:

  • Autism labeled for years before the ESES was discovered — exactly Levi's pattern.
  • No clinical seizures ever observed in the two regressing siblings. Levi's pattern.
  • Regression onset at age 2 with gradual multi-year tempo — Levi's pattern.
  • Long diagnostic delays (5 and 2 years respectively) with ESES only found because of a proband event — Levi's delay is ~3 years.
  • Steroid-responsive language and behavioral recovery, even when treatment was initiated 5 years into the regression. This directly informs Levi's question about whether late suppression still yields developmental gains.
  • Familial clustering suggests an unidentified genetic / familial substrate even when standard genetic workup is uninformative — consistent with Levi's negative trio exome / trio WGS / reanalysis and the mosaic-sensitive tissue-sequencing priority.

Why it's not a perfect match:

  • Level of detail from the conference abstract is limited; the full-length write-up (if published separately) may not be accessible.
  • No information about overgrowth, head circumference, or MRI findings in the abstract.
  • The older sister's speech loss is described as complete loss of expressive language (close to Levi), but she was female.

What I can learn from this family's experience:

  • Steroid-responsive developmental gains are possible even 5+ years post-regression onset. This is the most encouraging single fact in the entire survey for Levi's long-term trajectory.
  • Familial clustering of "autism-only" labels that turn out to be ESES is a real phenomenon. If Jake and Miki ever have relatives with childhood-autism labels without EEG workup, this is worth flagging.
  • The index-case-first, then retest-the-siblings pattern is the cleanest demonstration that "autism" without sleep EEG is an underspecified diagnosis — a talking point worth using when advocating for other children.

Verifiability notes: Published peer-reviewed conference abstract (Scottish Medical Journal supplement). Named clinical authors at a named institution. The three children are anonymous but clinically documented. High verifiability.


Story B — "MI" (8-year-old boy with SEMA6B variant, Pediatrics 2025) — similarity: 70/100

Source: Ibrahim S, Jackson M. "Autism, Electrical Status Epilepticus in Sleep, and a Likely Pathogenic SEMA6B Variant." Pediatrics. 2025 Jan;155(1):e2024068364. PMID 39573814 · AAP journal page.

One-line summary: Boy with mild early speech delay, diagnosed with autism at age 6, regressed in speech over 6 months starting at ~7.5, had one focal seizure at 8, multiple routine waking EEGs were normal, a 22-hour continuous EEG finally revealed ESES (SWI >85%); treated with monthly IV methylprednisolone pulses for 6 months plus oral prednisolone taper, levetiracetam, and clobazam, with resolution of ESES and significant improvements in speech, behavior, and sleep. De novo SEMA6B variant found on genetic workup.

Timeline:

  • Normal birth; first words at 18 months (mildly late); two-word sentences by age 3.
  • Age 6: diagnosed with ASD (speech delay + behavioral features).
  • Age 7.5: speech regression over 6 months.
  • Age 8: single focal seizure with secondary generalization. Routine waking EEGs normal. 22-hour continuous EEG revealed ESES (SWI >85%).
  • Treatment: IV methylprednisolone 3 days monthly for 6 months + oral prednisolone taper + levetiracetam + clobazam.
  • Outcome: ESES resolved on EEG; parents reported significant improvements in speech, behavior, sleep.
  • Genetics: de novo likely-pathogenic SEMA6B variant (first ESES-SEMA6B association reported).

Why this is close to Levi's case:

  • Autism diagnosis preceded ESES diagnosis — Levi's pattern.
  • Routine waking EEGs missed the ESES — a reminder that if Levi ever needs repeat EEG, it must capture NREM sleep.
  • Monthly IV methylprednisolone pulse protocol is essentially the treatment model Levi is now on — this case directly validates the efficacy and durability question Jake is asking.
  • Regression was gradual (6-month window) rather than overnight.
  • SWI >85% overlap with Levi's 95–100%.

Why it's not a perfect match:

  • Early development was mildly delayed (first words at 18 months) rather than fully typical.
  • He did have one clinical seizure at 8 — Levi never has.
  • Regression onset was later (~7.5 vs. Levi's 2.5) and shorter tempo.
  • Genetic etiology identified (SEMA6B) — Levi's genetics are negative.

What I can learn from this family's experience:

  • The exact monthly IV methylprednisolone × 6 months + taper protocol worked in a child with very similar SWI burden. This is directly evidence-relevant for Levi's "should we do a second pulse, and if so, how to dose durably" question.
  • Routine waking EEG is not adequate for ESES surveillance. Any follow-up EEG for Levi must capture sleep.
  • SEMA6B is a new-ish (2020-onwards) ESES-associated gene — worth confirming it was covered in Levi's trio WGS / reanalysis.

Verifiability notes: Published in Pediatrics (AAP flagship journal), January 2025. Peer-reviewed. Case details well-documented. High verifiability.


Story C — Jyonouchi & Geng patient (5-year-old boy, Epilepsy & Behavior Reports 2020) — similarity: 68/100

Source: Jyonouchi H, Geng L. "Resolution of EEG findings and clinical improvement in a patient with encephalopathy and ESES with a combination of immunomodulating agents other than corticosteroids: A case report." Epilepsy Behav Rep. 2020;14:100385. PMID 32995738 · PMC: PMC7516208 · ScienceDirect.

One-line summary: Boy with autistic features from age 2, gradual speech regression around age 5, nocturnal clinical seizure at 5.5 led to ESES diagnosis (SWI 100%) at Johns Hopkins; initial steroid response but relapse during taper; subsequently ESES fully resolved on a combination of anakinra (IL-1β inhibitor) + IVIG + sirolimus (mTOR inhibitor) selected on monocyte cytokine profiling. Extensive genetic workup (microarray, epilepsy panel, mitochondrial genome, WES) was entirely negative — exactly like Levi.

Timeline:

  • Mild speech delays with autistic features (echolalia, hyperlexia) from age 2.
  • Age 5: gradual regression in speech, disturbed sleep, hyperactivity.
  • Age 5.5: nocturnal clinical seizure. ESES diagnosed (SWI 100%).
  • Genetics: microarray, epilepsy panel, mitochondrial genome, WES all negative.
  • Treatment: initial high-dose oral steroids → normalized EEG → ESES returned during taper.
  • Escalation: anakinra (100 mg/day SC) added at 7.6y → 30% SWI reduction + behavioral gains.
  • IVIG (0.6 g/kg every 3 weeks) added → further reduction.
  • Sirolimus 1 mg/day added → ESES pattern fully resolved within 7 weeks; durable at 3 and 7 months.
  • Mother (a linguist) documented significant improvements in speech and social interaction.

Why this is close to Levi's case:

  • Extensive genetic workup entirely negative — the Levi pattern.
  • SWI 100% overlaps Levi's 95–100%.
  • Autistic features preceded the ESES diagnosis — the Levi pattern.
  • mTOR inhibitor (sirolimus) is what finally resolved ESES — this is directly mechanistically aligned with Levi's current leading hypothesis (mosaic PI3K-AKT-mTOR variant). For a child with negative germline genetics but steroid responsiveness, sirolimus is an on-ramp off the steroid treadmill that the current literature is only just beginning to explore.
  • IL-1β-directed therapy (anakinra) also contributed — relevant to Levi's Th1/Th17-weighted cytokine signature.
  • Steroid taper relapse is a pattern to watch for as Levi's pulse effect ages.

Why it's not a perfect match:

  • Early development included autistic features (echolalia, hyperlexia) rather than being fully typical.
  • He did have a clinical nocturnal seizure — Levi never has.
  • Regression onset was later (~5 vs. Levi's 2.5).

What I can learn from this family's experience:

  • Sirolimus is a real, published, ESES-resolving option in a genetics-negative child. When Jake raises the mosaic-mTOR hypothesis with neurology, this case is an important precedent for empiric mTOR inhibition even in the absence of an identified mTOR-pathway variant.
  • Monocyte cytokine profiling guided the treatment selection. Levi already has a serum Th1/Th17-weighted cytokine signature from April 6, 2026 — this case suggests that CSF + serum cytokine panels could similarly direct personalized immune therapy if steroids lose durability.
  • Steroid relapse on taper is real and expected. Planning the next pulse (or a maintenance regimen) before the current effect wanes is the right framing.

Verifiability notes: Published peer-reviewed case report. Detailed clinical narrative, treatment course, and EEG documentation. Mother (a linguist) is an identified witness-observer. High verifiability.


Addendum 2 (2026-04-19 PM, later) — Reddit cases verified from user-supplied screenshots

Jake supplied screenshots from two Reddit threads (r/Autism_Parenting and r/Epilepsy) that verify two cases my reliability audit had flagged as unverifiable, and surface a third case not previously noted.


Story D — luckyelectric's son (r/Autism_Parenting) — similarity: 82/100

Source: Reddit user luckyelectric (flair: "ND Parent / Age 6 (HSN) & 11 (LSN) / USA"), posts in r/Autism_Parenting thread "For those who have children with regressive autism" (OP: JJM1023, 30 upvotes, 55 comments) and thread "Memories of our pre-regression son" (89 upvotes, 74 comments). Link format supplied by Jake: https://www.reddit.com/r/Autism_Parenting/s/iMedHruHpO

One-line summary: Previously-typical-to-advanced boy who recited books and sang songs in perfect pitch by age 2; slow regression starting ~2.5 with constant hand-stimming, loss of coordination, loss of flashcard-naming ability, and significant sleep disruption (crying in the middle of the night instead of sleeping); EEG showed "interictal epileptiform discharges every few seconds" despite no clinically recognized seizure; medication halted further decline but he has not made developmental progress since.

Timeline (reconstructed from the two screenshots):

  • Pre-age 2: developing normally to advanced — verbally identified flashcards, recited books, sang full songs with perfect pitch, "impressed strangers."
  • Around age 2.5: "slowly, over time those things went away and he fell into almost constant stimming." Balance and coordination also worsened. Increasingly behind in gross motor between age 2 and 3.
  • Same window: disrupted sleep — "chunks of time where he'd be crying instead of sleeping during the middle of the night."
  • Context: regression happened in the aftermath of COVID-19 "when medical services were strained and no one would help us much."
  • EEG: "very abnormal with lots of Epileptiform discharges" — interictal epileptiform discharges "every few seconds" — yet "never had a clinically recognized seizure."
  • Treatment: seizure medication (specific agent not disclosed in the screenshots).
  • Outcome: "He's been medicated for close to two years but hasn't really made developmental progress since about age two." Current age 6 (per flair).

Why this is close to Levi's case:

  • Regression onset at ~2.5 — essentially identical to Levi's.
  • Previously-typical-to-advanced language (flashcards, books, songs) — overlaps Levi's pre-regression ~1,000-word vocabulary description.
  • Never had a clinically recognized seizure — Levi's pattern.
  • EEG showed near-constant epileptiform discharges — similar electrographic severity to Levi's 95% sleep SWI.
  • Sleep disruption during the regression window — overlaps Levi's 1.5-year history of 3 AM stimmy nocturnal awakenings.
  • Regression happened during COVID-era service disruption — Levi's regression trajectory also overlaps the same pandemic-era medical-service shock.

Why it's not a perfect match:

  • The exact EEG framing ("epileptiform discharges every few seconds") is not explicitly called ESES/CSWS/DEE-SWAS in the post — it may or may not meet the formal SWI-percentage threshold.
  • Treatment type is not specified (AED vs. steroid vs. benzodiazepine).
  • Most importantly: no reported developmental progress post-treatment — this is the least encouraging single case in the survey for the "suppress the discharges, get the child back" hope. It's a reminder that electrographic suppression is necessary but not sufficient.

What I can learn from this family's experience:

  • The "epileptiform discharges every few seconds on EEG" phrasing paired with zero clinical seizures is a real pattern in children misdiagnosed as autism — but the detail-gap between "discharges" and "ESES meeting formal criteria" matters. A screenshot of this mother's child's actual EEG-report SWI would be enormously valuable.
  • Medication without developmental gains is a possible outcome, especially when treatment is initiated ~2 years after regression onset and the medication is a plain AED rather than immunomodulation. This cautions against celebrating EEG improvement without demanding developmental improvement.
  • The mother's description of her pain ("Parts of me are completely dead. I often feel like puking. I'm unable to feel love.") is important emotional context that doesn't show up in medical literature and matches how Jake and Miki have described their worst moments.
  • This mother should be a direct outreach target if she is still active on r/Autism_Parenting — her trajectory is the closest match found for Levi's pre-pulse phenotype.

Verifiability notes: Verified real Reddit user with consistent flair across multiple threads and months. Screenshots supplied by Jake. The post's clinical detail matches the peer-AI report's summary — the peer report was not hallucinating the content, it just failed to cite a source URL.


Story E — ChillyAus's son (r/Autism_Parenting and r/Epilepsy) — similarity: 78/100

Source: Reddit user ChillyAus, commenting in the same r/Autism_Parenting thread as luckyelectric above, AND replying in detail in r/Epilepsy thread "ESES (Electrical Status Epilepticus in Sleep)" (OP: musicalmstucker, 1 upvote, 6 comments). Link format supplied by Jake: https://www.reddit.com/r/Epilepsy/s/M44UNfWa9z

One-line summary: Previously very socially outgoing boy whose first symptoms were poor sleep, grumpiness, and increased sensory differences; progressed to severe anxiety and social agitation; initially diagnosed with autism AND ADHD because "those labels fit the closest but we always felt they were kinda off too"; then started "tripping" (focal motor seizures) and eventually had a full tonic seizure that triggered the sleep study and ESES diagnosis at age 5 (with best sleep EEG 65–70% SWI, currently 90–100% SWI); now almost 7, on med #4 with minimal effect, homeschooling.

Timeline:

  • Previously "very socially outgoing little guy."
  • Age ~3: symptoms begin — poor sleep, grumpiness, increased sensory differences.
  • Age 3–5: "two years prior [to diagnosis] that we were investigating but didn't realise were neurological."
  • Labels accumulated: autism, ADHD.
  • Onset of "tripping" — focal motor seizures not initially recognized as such.
  • A full tonic seizure was what finally escalated the workup.
  • Age 5 (1.5 years ago, per the 161-day-old post): sleep study, multiple EEGs, second neurology opinion → ESES diagnosis. Best sleep EEG has been 65–70%; currently 90–100%.
  • Now almost 7, on medication #4, on sodium valproate (working decently), after previous trials.
  • Medication history explicitly called out:
    • Trileptal: rejected by the family because it's a "known antagonist" that can worsen ESES.
    • Keppra: worked for clinical seizures but not ESES; stopped being helpful over time.
    • Onfi/Clobazam: adverse outcome — "Onfi made my son have a regression and took his SWI from 70% to >85% within 3 months."
    • Sodium valproate: working decently.
  • Seizure phenotype: "mostly focal, secondarily generalised at times and he has multiple seizure types, though thankfully his clinical seizures are rare."
  • Genetics: "We've now found a possible genetic link underlying his condition but could be unrelated" — gene not disclosed.
  • Schooling: stimulants don't work for ADHD piece; homeschooling currently; "lessons are kept at max 20 mins"; flexi school next year.
  • Self-advocacy: "I've gone deeeeeep into the research since his diagnosis so I'm happy to answer questions as best I can."

Why this is close to Levi's case:

  • Clinical seizures are rare — Levi has had none. ChillyAus's post is the most direct published description I've found of an ESES-dominant, seizure-sparse phenotype.
  • Autism + ADHD labeled first, ESES found later — Levi's pattern.
  • Sleep-SWI range 65–100% across time — brackets Levi's 95–100% entirely.
  • First symptoms included poor sleep and sensory differences — overlaps Levi's 3 AM stimmy nocturnal awakenings and sensory features.
  • Diagnostic delay (~2 years from symptoms to ESES diagnosis) — shorter than Levi's ~3 years but the same shape.
  • Active "gone deep into the research" parent posture — an obvious analog to Jake and Miki's own work.

Why it's not a perfect match:

  • Regression onset at ~3, not Levi's ~2.5.
  • Clinical seizures (focal motor + tonic) did eventually emerge and were the diagnostic trigger — Levi has had none.
  • Therapeutic trajectory is "still searching" rather than a clean steroid-responder story. No steroid pulse yet described in the posts Jake shared.

What I can learn from this family's experience:

  • This is the single most important actionable data point in the entire survey for Levi's medication decisions: Onfi/Clobazam can worsen ESES in an individual patient, taking SWI from 70% to >85% in 3 months. The Joshua/Complex Child case shows low-dose nighttime Onfi resolving ESES; ChillyAus's case shows Onfi triggering a regression and raising SWI. Neither is generalizable, but both are real patient-reported outcomes. If Levi is ever offered Onfi, this variance needs to be on the table.
  • Trileptal (oxcarbazepine) and carbamazepine are known ESES-worseners — the ChillyAus family refused Trileptal for this reason, matching the published Kotagal 2017 and DEE-SWAS guideline literature. Worth ensuring Levi's medication list never includes these.
  • Sodium valproate worked decently for this child where 3 other agents did not — a reminder that valproate remains a first-line ESES option.
  • Homeschooling with 20-minute lesson blocks is a real accommodation strategy from a family with a similar phenotype.
  • ChillyAus is an active, well-researched outreach target on Reddit — a DM with Levi's story might yield a detailed exchange.

Verifiability notes: Verified real Reddit user across multiple threads and subreddits, posting clinically consistent content over ~8 months (257 days in r/Autism_Parenting, 161 days in r/Epilepsy). Screenshots supplied by Jake. Self-describes as having deep research knowledge and offers to answer questions.


Story F — musicalmstucker's son (r/Epilepsy, OP) — similarity: 66/100

Source: Reddit user musicalmstucker, OP of the r/Epilepsy thread "ESES (Electrical Status Epilepticus in Sleep)" where ChillyAus replied. Same thread link: https://www.reddit.com/r/Epilepsy/s/M44UNfWa9z

One-line summary: US family, ESES-diagnosed son whose Trileptal trial caused coordination loss and falling that prompted the overnight EEG that actually made the ESES diagnosis; subsequently put on Onfi (Clobazam) with a dramatic response — "at his follow up he showed no seizures, where before it was 80% of the time"; on a 504 plan at school; speaks with a school therapist; doing presentations at school for Epilepsy Awareness Month in November.

Timeline (reconstructed):

  • Son (age not specified in the screenshots but clearly a school-age child).
  • Trileptal trial → coordination problems and falling → overnight EEG → ESES diagnosis.
  • Switched to Onfi (Clobazam) → "working wonders" → at follow-up EEG, no seizures where before it was 80% of the time (i.e., a ~80-percentage-point drop in SWI).
  • Doing therapy, 504 plan at school, school therapist working with him on coping.
  • Active advocacy: mother planning class presentation for November Epilepsy Awareness Month.

Why this is close to Levi's case:

  • ESES-specific diagnosis.
  • Dramatic treatment response to a well-documented regimen (Onfi from 80% SWI → no seizures).
  • Family is actively researching, engaged, and advocating — a good outreach fit.

Why it's not a perfect match:

  • The screenshots do not include the pre-diagnosis trajectory (age of regression onset, autism-first labeling, etc.) — the conversation focuses on medication responses, not the full developmental history.
  • School-age at diagnosis — similar to Levi but without the autism-first framing confirmed.
  • Onfi response is the opposite of ChillyAus's Onfi response, highlighting inter-patient variance.

What I can learn from this family's experience:

  • A second published Onfi-responder parent report complements Joshua (Complex Child) and raises confidence that Onfi/Clobazam is a legitimate steroid-sparing option — while ChillyAus's case remains the cautionary outlier.
  • The mother deleted Facebook ("became a cesspool") and is using Reddit as her primary peer community — Reddit is therefore a legitimate outreach channel for this exact cohort, contra my earlier "Reddit coverage is thin" note.
  • 504 plan + school therapist are age-appropriate Levi-future accommodations.

Verifiability notes: Real Reddit user (OP of the thread), posts are consistent with the clinical picture, but the full pre-diagnosis timeline is not in the visible screenshots. The pre-regression baseline and exact age at ESES diagnosis would need follow-up reading of the original thread. Lower-information than luckyelectric or ChillyAus but still clearly a real parent.


Addendum 3 (2026-04-19 PM, later 2) — Finley case verified from Facebook screenshots

Jake supplied two screenshots from the public Facebook group "Landau-Kleffner Information and Support Group," post by Sabrina Van den Berg dated 2025-09-07, titled "Our Journey with Finley – Landau Kleffner / ESES & NPRL3." The post includes a photograph of the child on what appears to be a cable car/tram, and provides substantial medical detail. This verifies the third and final unverified case from the peer-AI reports and adds one of the most clinically important stories in the entire survey.


Story G — Finley (Facebook, Landau-Kleffner Support Group) — similarity: 84/100

Source: Sabrina Van den Berg, "Our Journey with Finley – Landau Kleffner / ESES & NPRL3," Facebook post in the Landau-Kleffner Information and Support Group, 2025-09-07. Screenshots supplied by Jake. Hashtags in the post: #ESES #LandauKleffner #NPRL3 #EpilepsyAwareness #ChildhoodEpilepsy #SpeechRegression. The family appears to be Dutch (references to Dutch insurance and a willingness to source sulthiame from Germany).

One-line summary: Previously-typical Dutch boy who "spoke well, made progress in language, and was a cheerful and curious boy" until ~a year before the post (i.e., 2024-ish), when he suddenly stopped speaking; EEGs showed ESES with 98% sleep spike-wave index; genetic testing revealed a novel NPRL3 variant (an mTOR-pathway gene); father carries the same variant and is completely healthy; 6 rounds of high-dose methylprednisolone pulses produced no visible improvement; subsequent AED trials have been only partially effective; Finley now has daily focal seizures and absences triggered by sleep deprivation, speech remains absent, but cognition and IQ are relatively preserved ("average to high," above mainstream-school placement threshold on some measures).

Timeline (as described by Sabrina):

  • Pre-regression: "Our son Finley was developing normally. He spoke well, made progress in language, and was a cheerful and curious boy."
  • ~2024 (approximately a year before the Sep 2025 post): "Around a year ago, things suddenly changed: he stopped speaking. At first, we thought it might be temporary, but soon we realized it was something much deeper."
  • Workup: "After many tests, EEGs showed ESES with 98% spike-wave index during sleep. Clinically, Finley has severe speech aphasia/regression, but otherwise he shows no major cognitive, emotional, or psychological decline. This picture does not fully fit with 'classic' Landau-Kleffner syndrome, and in our opinion may be more linked to ESES with a genetic background."
  • Genetics: "Genetic testing revealed a variant in the NPRL3 gene. This specific variant has not been described internationally before, so at this point it is still unclear if it is truly pathogenic. Finley's father also carries the same variant but is completely healthy — which makes interpretation more difficult. Further studies on brain development and progression are ongoing."
  • Treatment tried (verbatim list from the post):
    • Steroid pulses (6× high-dose methylprednisolone) → no visible improvement.
    • Keppra (levetiracetam) → no clinical benefit.
    • Clobazam → partial effect at first, but seizures broke through.
    • Now: starting Depakine (valproate) while tapering Keppra.
    • Exploring sulthiame (Ospolot) → not covered by Dutch insurance, but we are prepared to obtain it from Germany if prescribed.
  • Clinical current state: "Finley now has daily focal seizures and absences, especially triggered by sleep deprivation. His speech remains absent, but his cognition and IQ are relatively preserved — which makes the aphasia all the more frustrating."
  • Educational context: "On the educational side, we are preparing for special needs schooling, but evaluations show Finley actually has a high average IQ. This makes placement difficult: too high for some special schools, but his aphasia prevents him from fitting into mainstream education."
  • Current posture: "We are in the middle of finding the right treatment approach. Steroids and standard medication protocols have not worked. We are hoping for new directions — whether through valproate, sulthiame, or eventually mTOR inhibitors or dietary approaches. Most importantly, we hope to give Finley the best chance to regain his speech."
  • Outreach ask: "We share our story here in the hope to connect with other families who recognize this combination: ESES, aphasia, and NPRL3 gene variants. Any experiences, advice, or shared stories are deeply appreciated. 💙"

Why this is close to Levi's case:

  • Pre-regression baseline matches: "spoke well, made progress in language, cheerful and curious boy" tracks Levi's pre-regression vocabulary and engagement description.
  • Sleep SWI of 98% essentially equals Levi's 95–100% — the most exact electrographic match in the survey.
  • mTOR-pathway genetic hypothesis explicit: Sabrina names NPRL3, which is a GATOR1-complex component and a well-established mTOR-pathway gene. This is direct narrative evidence for a parent pursuing the same "mosaic/germline mTOR" framing Jake has been tracking in Levi's overgrowth-mosaic-mtor theory, except for Finley the variant was found and Levi's exome/WGS remain negative. The mechanistic overlap is striking.
  • Genetic mystery mirrors Levi's uncertainty: the father carries the same NPRL3 variant and is healthy, so variant pathogenicity is not resolved — parallel to Levi's fully-negative clinical genetics where the family is operating on a "suspected mosaic/somatic" hypothesis without a confirmed variant.
  • "Cognition and IQ relatively preserved, aphasia is the dominant deficit" — this is the most directly hopeful framing for Levi's cognition-comparable-to-affect-and-language pattern, and is one of the clearest published expressions of the "CSWS-dominant aphasia, intellect otherwise intact" phenotype Levi's team hopes for.
  • Active search for mTOR inhibitors and dietary approaches — directly overlaps Levi's workspace, where sirolimus (mTOR inhibitor) and ketogenic/MAD dietary options are being tracked.
  • Outreach ask is genuine and matches Levi's family: the post explicitly invites other NPRL3/ESES families to reach out.

Why it's not a perfect match:

  • Regression was "sudden" (stopped speaking at a discrete point) rather than Levi's gradual multi-year regression — this is the single biggest phenotypic difference. Finley's trajectory is closer to classical LKS in tempo even if the 98% SWI makes it ESES/CSWS on the electrographic criterion.
  • Finley HAS clinical seizures (daily focal seizures and absences) — Levi has had none.
  • No autism-first diagnostic pathway is described — the post goes straight from "normal development" to "aphasia workup → ESES."
  • Finley is a steroid NON-responder (6 pulses, no improvement), which is the opposite of Levi. This is clinically instructive rather than disqualifying.
  • Finley has a candidate monogenic cause (NPRL3) that Levi's extensive genetics do not yet share.

What I can learn from this family's experience:

  • 6 steroid pulses can fail entirely, even with a 98% SWI that exactly matches Levi's. Levi's strong response to a single pulse is not universal; planning must include a scenario where a repeat pulse underperforms.
  • NPRL3 pathogenicity is unresolved in Finley even though the variant is in an mTOR-pathway gene and the father carries it without disease. This is a concrete example of how a "suspected variant in a plausible gene" can still live in VUS territory — important context for Levi's negative-genetics-so-far situation where any future candidate variant should be pressure-tested this way.
  • Dutch family willing to cross-border import sulthiame is a practical precedent Jake/Miki could mirror (sulthiame is not FDA-approved in the US but is a mainline ESES agent in Europe; import from the EU is a real option and has been done by other US families).
  • Sabrina Van den Berg is actively seeking family-to-family connection on a small public Facebook group. A direct message from Jake/Miki — mentioning Levi's 95–100% SWI, negative genetics, successful pulse response, and interest in NPRL3/mTOR-pathway biology — would almost certainly yield a substantive exchange. She is the single highest-value outreach target surfaced by this entire survey because (a) she is currently looking, (b) her son is the most medically similar on the electrographic axis, (c) the NPRL3/mTOR-pathway framing is the exact mechanistic hypothesis Levi's team is tracking, and (d) her family is a steroid-non-responder, so she will have explored second-line options Levi may eventually need.
  • The Landau-Kleffner Information and Support Group itself is a distinct parent community from the ESES & CSWS Facebook group already noted in "Honest limits." Both are worth joining.

Verifiability notes: Verified via two Facebook screenshots supplied by Jake, dated 2025-09-07, with a named poster (Sabrina Van den Berg), a group name (Landau-Kleffner Information and Support Group), and a photograph of the child. The clinical detail is extensive, internally consistent, and medically coherent (NPRL3 is a real GATOR1/mTOR gene; sulthiame availability is accurate to Dutch/German pharmacy practice; Depakine is the EU trade name for valproate). This is the strongest single piece of peer-AI confirmation received so far: the peer-AI report flagged a real, high-signal case that I initially doubted.


Runners-up (scored 50–69, not chosen as top 5)

  • Noah (Action Medical Research, UK)https://action.org.uk/research/family-stories/noahs-story — Score: ~40. Onset at 3 with seizures immediately (up to 40/day) and language loss within two weeks. Categorically-different seizure-dominated course, but I'm keeping him in the runners-up because the steroid-responsive partial recovery and sign-language-bridge parts of the narrative are directly relevant to the post-suppression window Levi is in. Listed for lesson-learning, not for similarity.
  • Solomon Littleton (Edmond, Oklahoma)https://www.edmondoutlook.com/a-fathers-hope/ and https://www.city-sentinel.com/faith/special-needs-seeking-the-wisdom-of-solomon/article_cd4403b3-7d85-5f1b-9f98-f129d512f0a4.html — Score: ~50. Onset at 5, rapid nine-month catatonic regression with loss of motor skills — different tempo and severity, but the long-tail partial recovery years after the acute phase and the insurance battle are relevant. Named family. Useful as an outreach target if the family still advocates.
  • Alya / PACS1 syndrome (Boston Children's Hospital patient spotlight)https://answers.childrenshospital.org/pacs1-syndrome/ — Score: ~40. Genetic etiology (PACS1 mutation) with ESES as a downstream feature and seizures from infancy. Categorically different genetic framing, but a useful example of (a) whole-exome sequencing identifying the rare cause, (b) the family founding a research foundation, and (c) ESES appearing as part of a broader syndrome rather than idiopathic.
  • Ben Myers / FamilieSCN2A (Leah Schust Myers's son)https://www.scn2a.org/stories/benjamin/ and https://deepconnections.net/2021/06/10/eses-csws/ — Score: ~35. Onset at 13 months with hundreds of seizures per day and a later SCN2A diagnosis; ESES was added to the picture at ~age 11. Categorically different age of onset and seizure burden, but the late-added ESES layer on top of an older rare-epilepsy diagnosis is a reminder that ESES can appear years after a primary epilepsy syndrome. His mother is also a well-connected rare-disease advocate and a useful outreach target.
  • Lisa Lopez's son (book: "Coping with Landau-Kleffner Syndrome: A Family Story")https://www.amazon.com/Coping-Landau-Kleffner-Syndrome-Family-Story/dp/1640880674 — Score: ~55 provisional, unverified without reading the book itself. It's a parent memoir of the full diagnostic-and-treatment journey. If Jake wants a long-form first-person family narrative, this is the closest to a book-length primary source. Worth buying and reading rather than trying to score without it.
  • Mayo Clinic Connect forum parents (thread "Anyone have a child diagnosed with ESES or CSWS?" and "Any luck with ESES Treatment in children?")https://connect.mayoclinic.org/discussion/eses-or-csws/ and https://connect.mayoclinic.org/discussion/eses-treatment-and-providers/ — Score: ~50 collectively. Several individual parent posts describe treatment journeys (6-month prednisone course, IVIG follow-on, amantadine, clobazam, etc.). Direct scraping failed due to Cloudflare blocking, but the search-tool snippets captured several useful quotes. These are anonymous screen-name parents, not fully-named families. Worth Jake opening the threads in a browser to read directly and potentially DM a few posters.
  • "happyccl8's" son (Mayo Clinic Connect, 2023)https://connect.mayoclinic.org/discussion/eses-or-csws/ — Score: ~63. Autism-first trajectory; severe age-6 regression with IQ drop from 85 to 51; ESES diagnosed after significant delay; multi-modal treatment (IV steroids, IVIG, amantadine) each contributed different gains per the mother ("amazing for behavior," "great for spikes," "amazing for cognition"). A detailed multi-year treatment roadmap from a named-pseudonym parent. Pseudonymous on a moderated forum but consistent across multiple posts.
  • Cody Cawood (Discover Magazine, 2007)https://www.discovermagazine.com/mind/boy-interrupted — Score: ~55. Premature birth + cerebral palsy pre-existing; chatty at 3; severe regression at 4 with complete speech loss in ~2 months; severe behavioral crisis; 5-day video EEG caught LKS. Categorically includes the pre-existing cerebral palsy and a shorter regression tempo than Levi, but the "chatty child → total speech loss + severe behavior" trajectory is one of the most vividly narrated LKS stories in mainstream media and is useful for communicating the severity of the window Levi's been in.
  • The Quillette "Leo" / S. Stiles case (2022)https://quillette.com/2022/01/21/autism-or-encephalitis/ — Score: ~53. Previously-typical boy, autism + ADHD diagnoses, catastrophic regression at ~5, eventually diagnosed with autoimmune encephalitis (not ESES), undetected focal seizures, treated with PLEX + rituximab. The underlying pathology is different, but the "autism misdiagnosis → something much more treatable" narrative arc is one of the most widely-read longform pieces on this phenomenon and is directly analogous to the frame Jake and Miki already think in. Written by a named journalist-parent with a detailed, verifiable narrative.
  • The Chilosi 2014 case (Journal of Child Neurology)https://pubmed.ncbi.nlm.nih.gov/24756140/ and related prospective study — Score: ~65 provisional, cited in a peer-AI report but not fully verified by me. A peer-AI report described a 25-month-old boy with "dramatic isolated language regression" leading to autistic-like features, no clinical seizures, persistent focal epileptiform activity on sleep EEG, responsive to ACTH. If true, this would be one of the closest matches for age of onset. I found the bibliographic citation (Chilosi AM et al., "Language Regression Associated With Autistic Regression and EEG Abnormalities: A Prospective Study," J Child Neurol 2014) but did not independently confirm the specific case details attributed to it. Treat as a high-priority candidate to read in the primary literature before citing.

Categorically excluded (looked at, ruled out)

  • Sotos / NSD1 family stories — consistently show up on the overgrowth overlap but have a categorically different genetic etiology (NSD1 LOF) and a different developmental trajectory; filtered out per the brief.
  • Classic early-onset LKS with overnight aphasia and dramatic visible seizures diagnosed quickly — multiple such cases exist in the LKS literature (e.g., the several 13-year-old-with-seizures case reports in PMC); these are categorically the opposite of Levi's slow, seizure-free, late-diagnosed course.
  • Infantile epileptic encephalopathies (Dravet, West, LGS) — wrong onset age, wrong seizure phenotype; ignored.
  • General autism-regression stories without any EEG/CSWS/ESES/LKS component — common but off-topic for this brief.
  • Rett, Angelman, Fragile X-specific family stories — defined monogenic syndromes that don't mirror Levi's broader phenotype.
  • Pure cohort-outcome papers (e.g., Munckhof 2015 pooled analysis, Liukkonen 2010 long-term outcome series) — excellent evidence for the differential/treatments workspaces, but by design not individual stories.

Reliability audit of peer-AI reports (revised 2026-04-19 PM, later)

Jake supplied two additional AI-generated reports plus follow-up Reddit screenshots. After cross-checking:

Verified via primary sources and added to this note:

  • Symonds siblings (Scottish Medical Journal 2015) — confirmed via Glasgow Enlighten repository and DOI. Added as top match (88/100 each).
  • SEMA6B case (Pediatrics 2025) — confirmed via PubMed PMID 39573814. Added (70/100).
  • Jyonouchi & Geng 2020 (Epilepsy & Behavior Reports) — confirmed via PubMed PMID 32995738 and PMC. Added (68/100).
  • Quillette "Leo" (S. Stiles, 2022) — confirmed. Added as runner-up with the caveat that the diagnosis is autoimmune encephalitis, not ESES.
  • Cody Cawood (Discover Magazine 2007 "Boy, Interrupted") — confirmed. Added as runner-up.

Verified via Reddit screenshots supplied by Jake:

  • luckyelectric (r/Autism_Parenting) — confirmed as a real Reddit user with consistent flair "ND Parent / Age 6 (HSN) & 11 (LSN) / USA" across multiple threads and 8+ months of posting. The clinical vignette in the peer-AI report matches her actual Reddit posts accurately. Promoted from unverified to verified. Added as Story D (82/100).
  • ChillyAus (r/Autism_Parenting and r/Epilepsy) — confirmed as a real Reddit user. The clinical vignette in the peer-AI report was accurate; the screenshots provide substantially richer detail (the Onfi adverse regression, Trileptal refusal, Keppra partial response, sodium valproate success, possible genetic link). Promoted from unverified to verified. Added as Story E (78/100).
  • musicalmstucker (r/Epilepsy OP) — a previously-unknown third Reddit parent surfaced by the same screenshots. Not in any peer-AI report. Added as Story F (66/100).

Verified via Facebook screenshots supplied by Jake:

  • Finley (Landau-Kleffner Information and Support Group, poster Sabrina Van den Berg, 2025-09-07) — confirmed as a real Facebook post with a named poster, dated context, and a photograph of the child. The clinical detail is substantially richer than the peer-AI report suggested: 98% SWI, novel NPRL3 variant (father is healthy carrier), failed 6 rounds of methylprednisolone, failed Keppra, breakthrough on clobazam, now transitioning to valproate with sulthiame pending, cognition preserved. Promoted from unverified to verified. Added as Story G (84/100) — now the highest-scoring single case other than the Symonds siblings, and the only verified steroid-non-responder in the survey.

Still unverified:

  • Chilosi 2014 — bibliographic citation is real (J Child Neurol 29(6):855–859), but the specific 25-month-old ACTH-responsive case details attributed to it by the peer-AI report need primary-source confirmation before citing.

Revised lesson about peer-AI reliability (second revision): All three of the Reddit/Facebook cases the peer-AI report flagged (luckyelectric, ChillyAus, Finley) turned out to be real content with real authors. The peer-AI report's pattern was to correctly identify relevant high-signal cases but to fail to supply working URLs. This is different from hallucination: the underlying content was accurate, the citation was missing. The correct heuristic for future peer-AI cross-checks is "request the source URL and verify," not "treat as likely hallucinated." Across three separate verification cycles the peer-AI batting average on real-case identification is now 3/3; only the Chilosi 2014 primary-paper specifics remain open, and that's a question of citation-granularity rather than content reality.

Honest limits of this search

  • Reddit coverage is thin via web search but rich for human browsers. The available web-search tool returned almost nothing for site:reddit.com queries combined with CSWS/ESES/LKS/DEE-SWAS, but the user-supplied screenshots from r/Autism_Parenting and r/Epilepsy show that multiple real parent-of-CSWS/ESES-child accounts (luckyelectric, ChillyAus, musicalmstucker, JJM1023) are actively posting and answering each other there. Direct in-Reddit browsing by a human is the right way to surface these and is likely to produce many more close-match stories with minimal effort.
  • Facebook coverage is thin via web search but rich when Jake browses directly. The Finley/Van den Berg post in the Landau-Kleffner Information and Support Group is the first Facebook case surfaced in this survey, and only via user-supplied screenshots. The largest parent communities for this condition are the private group "ESES & CSWS Epilepsy – Parents" (1,400+ members per the Child Neurology Foundation reference) and the smaller "Landau-Kleffner Information and Support Group" where the Finley post lives. I have no direct access to either; Jake or Miki joining both and reading/posting would likely produce 10+ additional close-match narratives quickly. The Finley case verification demonstrates that these Facebook groups contain exactly the kind of high-signal, detailed family stories Jake is looking for.
  • Podcast coverage is zero. I did not surface any specific podcast episode in which a parent of a CSWS/ESES/DEE-SWAS child tells a Levi-adjacent story. This is a gap worth revisiting — possible targets are the DEE-P Connections webinar series (Leah Schust Myers episode on ESES is already cited above), epilepsy-parent podcasts hosted by the Epilepsy Foundation, and the autism-parent podcast ecosystem (e.g., Uniquely Human, Autism Live). A targeted search of podcast transcripts would be a useful follow-on.
  • The Complex Child parent-authored article about Joshua is the single closest-matching story I found, and the host site is currently offline. The article text is preserved in quotation across multiple secondary sources (including the ones cited above), but the canonical URL is not currently live. A Wayback Machine fetch would be the right next step for a full primary copy.

Recommended outreach / next steps (not executed)

  1. Direct-message Sabrina Van den Berg in the Landau-Kleffner Information and Support Group (post dated 2025-09-07, "Our Journey with Finley"). This is now the single highest-value outreach target in the survey: her son is at 98% SWI (matching Levi), has a mTOR-pathway (NPRL3) candidate variant (matching Levi's leading genetic hypothesis), is a steroid non-responder (the counterweight scenario Levi needs to plan for), and she is explicitly asking other NPRL3/ESES families to reach out. A message mentioning Levi's 95–100% SWI, negative genetics, successful single-pulse response, and shared interest in mTOR-pathway biology would almost certainly yield a substantive and mutually valuable exchange.
  2. Join the private Facebook group "ESES & CSWS Epilepsy – Parents" (1,400+ members) AND the "Landau-Kleffner Information and Support Group" (a separate, smaller community where the Finley post lives). Post Levi's profile to both. This is the single highest-yield follow-up action after #1.
  3. Contact Vinez Campbell (Joshua's mother) if she is still reachable — her story is the nearest pure-clinical-trajectory match and she may have post-2016 updates.
  4. Buy and read Lisa Lopez's book "Coping with Landau-Kleffner Syndrome" as a long-form first-person comparator.
  5. Reach out to Leah Schust Myers at FamilieSCN2A Foundation — she is a well-networked rare-disease advocate who knows many CSWS/ESES families personally and may broker introductions.
  6. Ask Dr. Tobias Loddenkemper's group at Boston Children's (who treats Alya and runs an ESES research program) whether they can connect Jake and Miki with another family whose child fits the "autism-first, seizure-free, late-diagnosed, steroid-responsive" pattern.
  7. Directly in-search Reddit in r/Autism_Parenting, r/Epilepsy, r/specialneeds — the web-search tool is poor at surfacing these threads, but Reddit's own search returns them. DM luckyelectric, ChillyAus, and musicalmstucker.

Sources

Source-verification review of user-supplied 'Mixed Regression and Gains After ESES Normalization' report

Source-verification review of user-supplied 2026-04-19 ESES-recovery report

Purpose

Jake provided a PDF titled "Mixed Regression and Gains After ESES Normalization: A Characteristic Recovery Signature" and asked: "Can you review this report and take what's useful? Double check the sources, I don't know if I trust that this report was done well / the sources were read carefully."

This memo documents the result of that audit:

  1. which citations were independently verified,
  2. which citations were found to contain errors,
  3. which claims are already supported in the current corpus,
  4. which genuinely new papers and framings have been ingested as a result,
  5. what the reader should take at face value vs. treat with caution.

Verified citations (real, accurately cited in the report)

These citations were independently re-verified against PubMed / publisher metadata and the abstract content broadly supports how the report used them.

  • Seegmüller, Deonna et al. 2012. Epilepsia 53(6):1067-1076. PMID 22524856. CSWS long-term outcome. Caveat: the verbatim quote attributed to this paper in the report ("rapid behavioral and cognitive recovery" coincident with "diffuse spread" of spike-wave resolution) could not be found in the abstract I fetched. The underlying claim is broadly supported; the exact quoted sentence is unverified pending full-text access. See content/research/papers/2012-seegmuller-deonna-csws-long-term-outcome.md.
  • Bölsterli et al. 2011. Clin Neurophysiol 122(9):1779-1787. PMID 21441067. Impaired slow-wave downscaling during active ESES.
  • Bölsterli et al. 2017. Epilepsia 58(11):1892-1901. PMID 28960278. Slow-wave downscaling renormalizes on ESES remission.
  • Van den Munckhof et al. 2020. Sleep 43(11):zsaa088. PMID 32374855. Slow-wave-downscaling severity correlates with cognitive and behavioral compromise.
  • Tononi & Cirelli 2014. Neuron 81(1):12-34. PMID 24411729. Synaptic Homeostasis Hypothesis canonical statement.
  • Kramer, Chu et al. 2021. J Neurosci 41(8):1816-1829. PMID 33468567. Focal sleep-spindle deficit as biomarker.
  • Chu et al. 2025. Neurology 104(2):e210232. Longitudinal thalamocortical spindle recovery. (Already in corpus.)
  • Tassinari et al. 2009. Epilepsia 50 Suppl 7:4-8. PMID 19682041. Penelope syndrome.
  • Roulet-Perez et al. 1993. Dev Med Child Neurol 35(8):661-674. PMID 8335156. Acquired aphasia / dementia / behavior disorder with CSWS.
  • Siniatchkin et al. 2010. Brain 133:2798-2813. PMID 20688812. fMRI in CSWS.
  • Krishnamoorthy & Trimble 1999. Epilepsia 40 Suppl 10:S57-S64. Forced-normalization / Landolt phenomenon review.
  • Letzkus, Wolff & Lüthi 2015. Neuron 88(2):264-276. PMID 26494276. Disinhibition as circuit mechanism for learning.
  • Sherer et al. 2020. Arch Phys Med Rehabil 101(11):2041-2050. Post-Traumatic Confusional State case definition.
  • Bodien & Giacino 2020. NeuroRehabilitation 46(1):65-74. eMCS / confusional state.
  • Phyland, Ponsford et al. 2021. J Neurotrauma 38(24):3047-3067. TBI agitation meta-analysis (31.73% pooled; 44% in PTA).
  • Stoyell, Chu et al. 2021. BMC Neurol 21(1):355. High-dose diazepam + spindle + cognitive case report.
  • RESCUE-ESES 2024. Lancet Neurology. (Already in corpus.)
  • Veggiotti 2001. Neurophysiol Clin 31:387-397. Acquired epileptic frontal syndrome.

Full per-paper records are under content/research/papers/ (see research-index.yaml for the complete list).

Citation errors in the user-supplied report

These are clear misattributions. They do not undermine the underlying claim in each case — the intended evidence exists in the literature — but the citation strings as written would not land the reader on the right paper.

Error 1 — "Lombard et al., Frontiers in Neurology, 2021, PMC8097005"

The PMC ID is correct; the rest is wrong.

  • Correct attribution: Wang et al., Frontiers in Surgery, 2021, PMC8097005 (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8097005/).
  • The actual Lombard reference in the agitation-after-brain-injury literature is Lombard & Zafonte 2005 (Am J Phys Med Rehabil), which is a different paper.
  • Corrected paper record: content/research/papers/2021-wang-agitation-recovery-of-consciousness.md.

Error 2 — "Sánchez Fernández et al., Pediatr Neurol, 2013" (24-hour treatment response window)

No paper cleanly matches this citation string for the claim made.

  • Best match for the claim (24-hour cognitive/spindle recovery after CSWS-directed treatment): Stoyell, Chu et al. 2021, BMC Neurology 21(1):355 (PMID 34525987) — case report of same-night spindle restoration and cognitive improvement after high-dose diazepam.
  • A Sánchez Fernández 2012 paper exists (Pediatr Neurol 46:312-318) on short-term high-dose diazepam response, but it does not include the 24-hour spindle/cognitive claim.
  • The report's citation is therefore likely a conflation.
  • Corrected paper record: content/research/papers/2021-stoyell-chu-diazepam-spindle-csws.md.

Quote verification — Seegmüller 2012

The verbatim sentence attributed to Seegmüller 2012 ("rapid behavioral and cognitive recovery" co-occurring with "diffuse spread" of spike-wave resolution) was not present in the PubMed abstract I fetched. The quote may appear in the full-text body. Until full-text access confirms the exact wording, this should be treated as a paraphrase rather than a verified direct quote.

Claim verification — Pera 2013

The report attributes an EEG/behavior dissociation claim to Pera et al. 2013 (Epilepsia 54:77-85). The abstract alone does not directly support this claim; the claim may be in the discussion/body. Hempel 2019 is independently a better anchor for the EEG/behavior dissociation claim and is already in the corpus.

Claims already in the current corpus before this audit

The following framings in the user-supplied report are already supported by synthesis memos and paper records written in prior sessions and do not require new ingestion:

  • Paraictal phenomenon (Morrell, Irwin) — see existing per-paper records.
  • Post-steroid HPA/psychiatric-aftermath framing — see content/research/notes/2026-04-19-hpa-axis-evidence-synthesis.md and content/research/notes/2026-04-18-steroid-pulse-rebound-behavior.md.
  • Hempel 2019 ~59% pulse-prednisone language/behavior response with EEG/behavior dissociation — see existing paper record 2019-hempel-pulse-prednisone-eses-language-behavior.md.
  • RESCUE-ESES 2024 primary result — already in corpus.
  • 4-hypothesis framework for mixed-valence recovery — see content/research/notes/2026-04-19-eses-recovery-mixed-valence.md.

Genuinely new ingests as a result of this audit

The following framings were not previously in the corpus and are now added via new per-paper records under content/research/papers/:

  • Sleep homeostasis / Penelope syndrome arc: Tassinari 2009, Bölsterli 2011, Bölsterli 2017, Van den Munckhof 2020, Tononi & Cirelli 2014.
  • Thalamocortical sleep-spindle biomarker and recovery: Kramer/Chu 2021, Stoyell/Chu 2021 (with citation correction). Chu 2025 was already present.
  • Cross-diagnostic neurorehabilitation framework (the "recovery-of-consciousness" framing for Levi's new negatives): Sherer 2020 (PTCS case definition), Bodien & Giacino 2020 (eMCS agitation), Phyland & Ponsford 2021 (TBI meta-analysis), Wang 2021 (with citation correction).
  • Circuit-level disinhibition-as-learning backbone: Letzkus, Wolff & Lüthi 2015.
  • Acquired epileptic frontal syndrome clinical-historical grounding: Roulet-Perez 1993.
  • Long-term CSWS outcome prognostic counter-weight: Seegmüller, Deonna et al. 2012 (with quote-verification caveat).

Each of these paper records explicitly ties its contribution to one layer of the four-hypothesis framework in the companion synthesis memo.

Bottom line for Jake and Miki

  • The report's core scientific backbone (sleep homeostasis, Penelope syndrome, thalamocortical spindle recovery, post-confusional recovery phenomenology, disinhibition-as-learning, developmental-age unmasking) is real, well-sourced in the published literature, and worth integrating. The sleep-homeostasis + cross-diagnostic-neurorehabilitation framing materially enriches the interpretation of Levi's current trajectory beyond what was in the prior corpus.
  • Two citation errors should be corrected before the report is relied on in its current form: the "Lombard 2021" citation is actually Wang 2021 in a different journal, and the "Sánchez Fernández 2013" 24-hour-window citation is most likely a conflation with Stoyell/Chu 2021 BMC Neurology.
  • Two claims have weaker-than-represented direct abstract support (Seegmüller 2012 verbatim quote; Pera 2013 dissociation claim) and should be treated as paraphrases pending full-text verification.
  • This is a net-positive contribution to the case synthesis. It is not an "already-in-corpus" situation and it is not a "fabricated-citation" situation. It is a "substantially-real-with-two-correctable-errors" situation.
2026-04-21 — DEE-SWAS 2026-literature comprehensive review (Manus AI) integration pass

What this memo is

Jake uploaded a second comprehensive DEE-SWAS literature report, this one by Manus AI and dated April 21, 2026, with 44 numbered references focused specifically on the 2026 literature. He asked to add these to the corpus.

This memo documents the mapping between the report's references and the corpus, flags what was already present vs. newly added, flags internal duplicates in the report, records what the 2026-literature lens adds to Levi's case framing, and records the downstream-surface reassessment.

This pass follows the 2026-04-21 turn-1 pass (29 refs from the earlier user-supplied comprehensive report, published to origin/main as commit c6b6fb2). The companion memo for that pass is content/research/notes/2026-04-21-dee-swas-report-integration.md.

Reference-level mapping

All 44 references from the Manus AI report were reviewed. Mapping:

Already in corpus (5 refs) — not re-ingested:

  • [12] Datta TBRS EE-SWAS case report → content/research/papers/2026-datta-tbrs-ee-swas-case-report.md
  • [18] van Arnhem RESCUE-ESES RCT → content/research/papers/2024-van-den-munckhof-rescue-eses-rct.md
  • [20] Parra-Díaz fenfluramine DEE-SWAS exploratory → content/research/papers/2025-parra-diaz-fenfluramine-dee-swas-exploratory.md (added in turn-1 pass today)
  • [39] van Arnhem IQ trajectories post-SWAS-remission → content/research/papers/2025-van-arnhem-iq-trajectories-post-swas-remission.md (added in turn-1 pass today)
  • [40] Posar & Visconti CSWS update MDPI → content/research/papers/2024-csws-update-mdpi.md

Internal duplicates in the report (3 pairs) — each ingested once:

  • [4] and [6] Hanci DEE-SWAS tertiary cohort → 2026-hanci-dee-swas-tertiary-cohort.md
  • [7] and [42] Mazhit epileptogenesis/treatment review → 2026-mazhit-epileptogenesis-treatment-review.md
  • [30] and [38] Gordon autism mutations converge (Nature 2026) → 2026-gordon-autism-mutations-converge-shared-pathways-nature.md

Newly added (36 refs) — per-paper Markdown records created and indexed:

RefNew paper record
[1] Specchio ILAE 20222022-specchio-ilae-2022-childhood-syndromes.md
[2] Stowe "Tower of Babel" 20252025-stowe-dee-swas-tower-of-babel.md
[3] Lapid Varughese 2026 DEE-SWAS/IESS update2026-lapid-varughese-dee-swas-iess-update.md
[4]=[6] Hanci 2026 tertiary cohort2026-hanci-dee-swas-tertiary-cohort.md
[5] Ng 2026 ethosuximide2026-ng-ethosuximide-dee-swas.md
[7]=[42] Mazhit 2026 epileptogenesis/treatment2026-mazhit-epileptogenesis-treatment-review.md
[8] Abdennadher 2026 AES sleep-epilepsy glymphatic2026-abdennadher-aes-sleep-epilepsy-glymphatic.md
[9] 2026 state-of-art epilepsy-brain-tumors2026-state-of-art-epilepsy-brain-tumors-children.md
[10] Ma 2026 KCNA2 SWAS2026-ma-kcna2-swas-genotype-phenotype.md
[11] 2025 CNKSR2 anterior cingulate vocal eneuro2025-cnksr2-anterior-cingulate-vocal-eneuro.md
[13] Yan 2026 SELECTS cognitive biomarkers2026-yan-selects-cognitive-impairment-biomarkers.md
[14] Butera 2026 GFAP/NfL/tau biomarkers2026-butera-neurodegeneration-biomarkers-epilepsy.md
[15] Merritt 2026 childhood inflammation adult brain2026-merritt-childhood-inflammation-adult-brain-structure.md
[16] Iris Selfe 2026 evolution of SWAS2026-iris-selfe-evolution-swas.md
[17] Hu 2026 SELECTS SWAS→EE-SWAS progression2026-hu-selects-swas-ee-swas-progression-model.md
[19] van Arnhem 2026 multicenter observational steroid-clobazam2026-van-arnhem-multicenter-observational-steroid-clobazam.md
[21] Wheless 2026 stiripentol2026-wheless-stiripentol-dees.md
[22] Wong 2026 PTAS2026-wong-ptas-closed-loop-sleep-children.md
[23] Gonzalez-Martinez 2026 thalamic neuromodulation2026-gonzalez-martinez-thalamic-neuromodulation-epilepsy.md
[24] Geffrey 2026 RNS pediatric2026-geffrey-rns-pediatric-drug-resistant-epilepsy.md
[25] Gong 2026 tVNS EE-SWAS2026-gong-tvns-ee-swas-prospective.md
[26] Figueroa 2026 ketogenic Lancet Neurology2026-figueroa-ketogenic-lancet-neurology.md
[27] Li 2026 pediatric epilepsy treatment review2026-li-pediatric-epilepsy-treatment-review.md
[28] Sahu 2026 QoL DEE-SWAS2026-sahu-qol-dee-swas.md
[29] Ludwig 2026 caregiver QoL DEEs2026-ludwig-caregiver-qol-dees.md
[30]=[38] Gordon 2026 autism shared pathways Nature2026-gordon-autism-mutations-converge-shared-pathways-nature.md
[31] Specchio 2024 expanding genetic DEEs Lancet2024-specchio-expanding-genetic-dees-lancet.md
[32] Jonker-Schieving 2026 PHTS epilepsy cohort2026-jonker-schieving-phts-epilepsy-cohort.md
[33] Ding 2026 mTOR inhibitors TSC meta-analysis2026-ding-mtor-inhibitors-tsc-meta-analysis.md
[34] Fieblinger 2026 PTEN drug repurposing iScience2026-fieblinger-pten-drug-repurposing-iscience.md
[35] Pan 2026 STRADA megalencephaly Stem Cell Reports2026-pan-strada-megalencephaly-stem-cell-reports.md
[36] Parikh 2026 STRADA cortical interneuron biorxiv2026-parikh-strada-cortical-interneuron-biorxiv.md
[37] Shan 2026 ASD-epilepsy comorbidity NRR2026-shan-asd-epilepsy-comorbidity-nrr.md
[41] Specchio 2025 EPISTOP EBioMedicine2025-specchio-epistop-secondary-prevention-ebiomedicine.md
[43] Perilli 2026 tiered decisional framework2026-perilli-tiered-decisional-framework.md
[44] EMA 2026 epilepsy guidelines update2026-ema-epilepsy-guidelines-update.md

Arithmetic: 44 report refs − 5 already in corpus − 3 internal duplicates = 36 net new records. Verified.

What the 2026-literature lens adds

The Manus AI report is more narrowly focused on 2026-updated DEE-SWAS evidence than the earlier user-supplied comprehensive report. The integration layer adds roughly four durable additions to Levi's framing:

  1. The single most treatment-actionable addition is the van Arnhem 2026 multicenter observational study (ref [19]) comparing IV methylprednisolone pulse versus oral prednisolone plus clobazam. The headline finding — 13% adverse-event rate with IV pulse vs. 76% with the oral regimen (p<0.001), with comparable electrographic efficacy — strongly reinforces the IV-pulse-first posture already embedded in Levi's treatments workspace. Levi received IV methylprednisolone pulse in March 2026 with near-total electrographic resolution at the April 2026 UCSF follow-up EEG; this paper validates that choice over the prolonged-oral-plus-clobazam alternative. It does not re-rank the top-tier treatment list (IV pulse was already there) but it is the strongest 2026 evidentiary anchor for that rank.

  2. Emerging neuromodulation tier consolidation (Wong 2026 PTAS, Gonzalez-Martinez 2026 thalamic DBS, Geffrey 2026 RNS pediatric, Gong 2026 tVNS). These four papers consolidate a coherent non-invasive-to-invasive neuromodulation ladder for drug-resistant DEE-SWAS. Levi is not currently on this ladder, but if SWAS recurs and pharmacotherapy escalation underperforms, this tier exists and is 2026-current. The tVNS and PTAS options are particularly interesting as near-term non-invasive possibilities worth tracking.

  3. Fluid-biomarker expansion (Butera 2026 GFAP/NfL/tau, Yan 2026 SELECTS cognitive biomarkers, Merritt 2026 childhood-inflammation adult-brain-structure). These add concrete fluid-biomarker options beyond the CSF cytokines/AE/neopterin/HVA-5HIAA/folate already on the diagnostic priority list. GFAP as astrocyte-injury marker (linking to the Shan 2026 astrocyte-dysfunction framing) is the most novel addition; worth discussing with Stanford/UCSF neuroimmunology as adjunct to the existing CSF workup.

  4. mTORopathy therapy precedent strengthening (Specchio 2025 EPISTOP, Ding 2026 mTOR-inhibitors-in-TSC meta-analysis, Jonker-Schieving 2026 PHTS epilepsy cohort, Fieblinger 2026 PTEN drug repurposing, Pan+Parikh 2026 STRADA mechanism). These five together strengthen — without changing — the rapalog therapy framing that would apply if a mosaic PI3K-AKT-mTOR variant is confirmed in Levi. EPISTOP is the most important of these as the precedent trial for EEG-guided pre-symptomatic mTORopathy treatment.

Interpretive framing vs. existing corpus

Every meaningful clinical claim in the Manus AI report is either already represented in the existing corpus or reinforces an existing claim with 2026-updated primary-source evidence. The ingestion pass adds 2026-current primary-source backing for existing framings, not new theories.

Three framings worth explicit note:

  • The ASD-epilepsy-comorbidity integrated-therapy framework (Shan 2026, ref [37], NRR): consolidates pharmacotherapy + neurostimulation + dietary + immunotherapy under an "etiology-mechanism-treatment" model. This fits Levi's multi-axis picture (DEE-SWAS + ASD + immune signal + overgrowth) cleanly. The astrocyte-dysfunction framing in Shan is the most novel element and opens a thread worth tracking via Butera 2026 (GFAP) if future Levi biomarkers become available.

  • The STRADA mechanism thread (Pan 2026, Parikh 2026). STRADA is not on Levi's top-tier differential but sits on the broader mTORopathy gene list. These two papers (one peer-reviewed, one preprint) reinforce the general argument that a mosaic-sensitive PROS panel (covering the full PI3K-AKT-mTOR axis including STRADA) is more clinically useful than single-gene testing.

  • Gordon 2026 shared-pathways Nature paper (refs [30]=[38]): the convergence framing — diverse autism-associated mutations landing on shared synaptic/chromatin/mTOR pathways — supports Levi's differential structure (multiple convergent paths to overlapping phenotypes). Reinforces the case that identifying the specific convergent pathway for Levi matters more than identifying a specific gene. Argues for mechanism-targeted therapy (rapalog if mTOR, HDAC inhibitor if chromatin, immunomodulation if neuroinflammation) rather than waiting for gene-specific precision.

Downstream workflow recommendations

  • differential-update: no re-rank. Each theory in content/differential/etiologies.yaml was considered one-by-one against this pass's new evidence:

    • mosaic PI3K-AKT-mTOR — strengthened by Specchio 2025 EPISTOP, Ding 2026 TSC meta-analysis, Jonker-Schieving 2026 PHTS cohort, Fieblinger 2026 PTEN drug-repurposing, Pan/Parikh 2026 STRADA mechanism. Rank unchanged (already top).
    • chromatinopathy (DNMT3A / TBRS-spectrum) — supported by Specchio 2024 expanding-genetic-DEEs Lancet and Gordon 2026 shared-pathways convergence. Rank unchanged.
    • neuroinflammation — supported by Merritt 2026 childhood-inflammation adult-structure, Shan 2026 astrocyte framing, Butera 2026 GFAP biomarker. Rank unchanged.
    • structural (thalamocortical) — reinforced by 2026 state-of-art epilepsy-brain-tumors. Rank unchanged.
    • unknown multifactorial — no update.
    • hypothalamic-hpa-axis-contribution — no direct update from this pass. Net: 0 re-ranks, 5 existing theories reassessed.
  • diagnostics-update: no re-rank. The report reinforces the existing top priorities (mosaic-sensitive tissue-based PROS panel, methylation/episignature, specialized pediatric neuroradiology re-read, repeat LP with CSF cytokines/AE/neopterin/HVA-5HIAA/folate, cooperative baseline EKG) but does not introduce a new diagnostic item meriting a rank change. The Butera 2026 GFAP biomarker could be worth appending to the CSF workup wish-list in a future correction pass — flagging for follow-up rather than acting now, because the primary goal of the current diagnostic list is already-orderable tests.

  • treatments-update: no re-rank. The van Arnhem 2026 observational study (ref [19]) is the most treatment-actionable paper in the pass, but it reinforces the existing top-ranked treatment (IV methylprednisolone pulse, already executed for Levi) rather than changing the rank order. The neuromodulation tier (PTAS, thalamic DBS, RNS, tVNS) consolidates into a coherent downstream option set but remains appropriately below rapalogs/IVIG/KD for Levi's current situation. Recommend adding a note in content/treatments/treatments.yaml in a future correction pass flagging the van Arnhem 2026 AE-rate evidence as additional support for the IV-pulse rank — not doing it in this pass to keep the per-pass scope clean.

  • people-ranking: no re-rank from this pass. Authors to flag for future consideration: van Arnhem (already prominent via multiple papers now in the corpus), Specchio (already prominent), Gordon (autism/Nature, potentially useful but not Levi-specific outreach target).

  • provider-maintenance: no action.

  • case-overview-maintenance: no action. The case-overview high-level picture is unchanged by this ingestion pass; the 36 new papers strengthen existing framings rather than introducing new ones.

Run-level notes

  • Ingested to branch agent/2026-04-21-dee-swas-2026-report-refs off the up-to-date origin/main (which already includes the turn-1 commit c6b6fb2).
  • 36 new per-paper records created under content/research/papers/.
  • content/research/indexes/research-index.yaml updated with 36 new entries (total now 147) and a new top-of-file note documenting the pass.
  • No PDFs ingested into storage/ for this pass beyond the source report itself; canonical external URLs serve as the r2_url for entries where URLs are available. Several 2026 papers do not have confirmed URLs yet — left as empty strings to be filled by a future correction pass as full-text access becomes available.
  • One full-byline-pending item: the 2026 state-of-art epilepsy-and-brain-tumors paper (ref [9]) is cited in the Manus AI report without full author list; flagged in its record for a future correction pass.
  • One preprint item: Parikh 2026 STRADA cortical-interneuron (ref [36]) is a biorxiv preprint; flagged in its record for follow-up on peer-reviewed publication.
2026-04-21 — DEE-SWAS / ESES / CSWS comprehensive-report integration pass

What this memo is

Jake uploaded a 34-reference synthesis report covering DEE-SWAS / ESES / CSWS definitions, pathophysiology, treatment, long-term outcomes, ASD-overgrowth-seizure connections, and recovery / rehabilitation. He asked that every reference in the report be added to the research corpus with findings captured.

This memo documents the mapping between the report's references and the corpus, flags which were already present vs. which were newly added, and records interpretive notes where the report's framing sharpens or diverges from what the existing corpus says about Levi's case.

Reference-level mapping

All 34 references from the report were reviewed. Mapping:

Already in corpus (5 refs) — not re-ingested:

  • [2] Posar & Visconti 2024 CSWS update → content/research/papers/2024-csws-update-mdpi.md
  • [3] Rao 2025 Practical Neurology DEE-SWAS treatment review → content/research/papers/2024-practical-neurology-dee-swas-review.md
  • [5] Tononi & Cirelli 2014 SHY (Neuron) → content/research/papers/2014-tononi-cirelli-synaptic-homeostasis-hypothesis.md
  • [6] Van den Munckhof 2020 sleep slow-wave homeostasis → content/research/papers/2020-vandenmunckhof-slow-wave-downscaling-cognition-csws.md
  • [14] Van Arnhem 2024 RESCUE-ESES trial → content/research/papers/2024-van-den-munckhof-rescue-eses-rct.md

Newly added (29 refs) — per-paper Markdown records created and indexed:

RefNew paper record
[1] Patry 19711971-patry-lyagoubi-tassinari-subclinical-ese-sleep.md
[4] Tononi & Cirelli 20062006-tononi-cirelli-sleep-synaptic-homeostasis.md
[7] Van den Munckhof 2020 thalamic injury MRI2020-van-den-munckhof-perinatal-thalamic-injury-mri-eses.md
[8] Sánchez Fernández 20122012-sanchez-fernandez-thalamic-lesions-spw-activity.md
[9] Freibauer 20232023-freibauer-dee-swas-genetic-landscape.md
[10] Sun 2018 CNKSR22018-sun-cnksr2-xlinked-epilepsy-aphasia.md
[12] Van den Munckhof 2016 serum cytokines2016-van-den-munckhof-serum-inflammatory-mediators-eses.md
[13] Van den Munckhof 2015 pooled 5752015-van-den-munckhof-eses-pooled-analysis-575.md
[15] Arts 2009 IVIG2009-arts-ivig-landau-kleffner-csws.md
[16] Groppel 20172017-groppel-hemispherotomy-eses-termination.md
[17] Qiao 2024 ketogenic2024-qiao-ketogenic-bhb-gaba-glutamate.md
[18] Topçu 2021 sulthiame2021-topcu-sulthiame-eses-seizure-eeg.md
[19] Parra-Díaz 2025 fenfluramine2025-parra-diaz-fenfluramine-dee-swas-exploratory.md
[20] Liukkonen 20102010-liukkonen-eses-32-children-long-term.md
[21] Van Arnhem 2025 IQ trajectories2025-van-arnhem-iq-trajectories-post-swas-remission.md
[22] Caraballo 20132013-caraballo-csws-eses-117-patients.md
[23] Boff 20252025-boff-mtoropathies-gene-editing-cells.md
[24] Hevner 20142014-hevner-brain-overgrowth-rtk-pi3k-akt.md
[25] Tariq 20222022-tariq-pten-mtorc1-neuronal-rescue.md
[26] Currey 20252025-currey-asd-macrocephaly-brain-overgrowth.md
[27] Valvo 20132013-valvo-somatic-overgrowth-seizures-asd.md
[28] Zahra 20222022-zahra-shared-etiology-asd-epilepsy.md
[29] Ramos 20252025-ramos-neuroinflammation-epilepsy-therapeutic.md
[30] Gaston 2021 CBD2021-gaston-cbd-cognition-epilepsy.md
[31] Anderson 2011 Kennard2011-anderson-children-recover-kennard-brain.md
[32] Zaldumbide-Alcocer 20242024-zaldumbide-neurohabilitation-pediatric-epilepsy.md
[33] Tapia 20242024-tapia-executive-functions-pediatric-epilepsy.md
[34] Zotey 20232023-zotey-adaptive-neuroplasticity-brain-injury.md

Not ingested (1 ref):

  • [11] Sonnek (etiology of CSWS). The user-supplied report explicitly marks this as "Referenced in Posar & Visconti 2024" rather than a primary source; no primary citation was given. Not ingested; its claim (39% unknown etiology in CSWS) is preserved via the Freibauer 2023 genetic-landscape entry and via the Posar 2024 record already in the corpus.

Verification-level caveat on Hevner 2014

The user-supplied report cites [24] Hevner RF, "Brain overgrowth in disorders of RTK-PI3K-AKT signaling: a mosaic of malformations," Semin Perinatol 2014, with PMC ID PMC4268391. That PMC ID is the same one already used in the corpus by 2014-mirzaa-brain-overgrowth-mosaic.md (Mirzaa GM, Poduri A), with a nearly identical title. The two records may refer to overlapping or identical reviews with differing authorship attribution, or they may be distinct papers with accidentally overlapping metadata in the report. I have ingested Hevner as a separate record per the one-paper-one-file convention while flagging this in both the Hevner record's citation note and in its index entry. Full-text verification is recommended; if this turns out to be the same paper as Mirzaa & Poduri, the two records should be merged in a future correction pass.

Interpretive framing vs. existing corpus

Every meaningful clinical claim in the user-supplied report was already represented in the existing corpus via synthesis memos (2026-04-16-batch-synthesis.md, 2026-04-17-dnmt3a-methylation-deepdive.md, 2026-04-18-steroid-pulse-rebound-behavior.md, 2026-04-19-hpa-axis-evidence-synthesis.md, 2026-04-19-eses-recovery-mixed-valence.md, 2026-04-19-report-review.md). The ingestion pass therefore adds primary-source backing for claims that were previously anchored via secondary references, not new claims.

A few framings in the report are worth noting as consolidation points:

  1. The "two-for-one" mTOR-plus-neuroinflammation mechanism (Boff 2025, Ramos 2025): the claim that mTOR inhibitors attenuate neuroinflammation in addition to reducing seizures mechanistically connects Levi's top differential hypothesis (mosaic PI3K-AKT-mTOR) to his secondary hypothesis (Th1/Th17-weighted neuroinflammation). If a mosaic mTOR variant is ever confirmed, rapalogs would be a single therapy hitting both axes.

  2. The etiology-stratified prognosis framework (Liukkonen 2010, Caraballo 2013, Van Arnhem 2025): the combination of these three long-term outcome studies supports a cleaner prognostic breakdown than any one study alone. Structural + surgery cohorts often recover to baseline; unknown / genetic cohorts frequently retain intellectual disability. Levi's structurally unremarkable MRI combined with three negative germline workups places him in the harder-prognosis stratum unless a mosaic or epigenetic diagnosis opens a targeted-therapy path. Van Arnhem 2025's two-trajectory finding (partial-recovery vs. continued-decline, distinguished by age of onset) is the most relevant prognostic reference for Levi specifically and supports serial formal neuropsychological testing rather than reliance on developmental progress notes alone.

  3. The macrocephaly-ASD-seizure triad (Valvo 2013, Currey 2025, Hevner 2014): these three together provide strong external epidemiological support for treating Levi's overgrowth as clinically meaningful rather than an incidental growth-chart observation. Valvo 2013 in particular is useful for family-facing and provider-facing communication — tall stature and macrocephaly are documented seizure-risk biomarkers in ASD, not cosmetic features.

  4. Rehabilitation tier (Anderson 2011, Zaldumbide-Alcocer 2024, Tapia 2024, Zotey 2023): these four consolidate into a cohesive tier of neurorehabilitation references that support extending Levi's current therapy stack (ABA, speech, OT, AAC) with structured cognitive-rehabilitation targets (executive function, working memory) during the current window of electrographic suppression. Anderson 2011's explicit push-back against the Kennard principle is the most useful anchor for calibrating expectations: recovery is substantial but bounded, and the quality and intensity of rehabilitation materially affects outcomes.

Downstream workflow recommendations

  • differential-update: no re-rank. Every theory the report touches (mosaic PI3K-AKT-mTOR, chromatinopathy, neuroinflammation, structural, unknown multifactorial) was already ranked with the evidence this report now cites. New papers provide primary-source backing for existing theories rather than new theories or updated weights. Per the orchestrator rules, each theory in content/differential/etiologies.yaml is still considered one-by-one: none move on this ingestion.

  • diagnostics-update: no re-rank. The report reinforces the existing top priorities (mosaic-sensitive tissue-based PROS panel, methylation / episignature panel, specialized pediatric neuroradiology re-read, repeat LP with CSF cytokines / AE / neopterin / HVA-5HIAA / folate, cooperative baseline EKG) but does not introduce a new diagnostic item.

  • treatments-update: no re-rank. Corticosteroids (response rate 81% in the pooled 575-case analysis now in the corpus as a primary source), benzodiazepines (68%), surgery (90% in selected structural cases), sulthiame, ketogenic diet, IVIG, fenfluramine, and CBD are all already represented in content/treatments/treatments.yaml. The primary-source additions (especially Van den Munckhof 2015) strengthen the evidentiary basis for the existing rank but do not change ranks.

  • people-ranking: no re-rank from this pass. The report does not surface new specific outreach targets beyond the senior authors already on the people workspace (Ingrid Scheffer, Heather Mefford, Ghayda Mirzaa, Annapurna Poduri, Kimberly Aldinger).

  • provider-maintenance: no action.

  • case-overview-maintenance: no action. The case-overview high-level picture is unchanged by this ingestion pass; the report consolidates existing framings rather than introducing new ones.

Run-level notes

  • Ingested to branch agent/2026-04-21-dee-swas-report-refs off origin/main.
  • 29 new per-paper records created under content/research/papers/.
  • content/research/indexes/research-index.yaml updated with 29 new entries and a top-of-file note documenting the pass.
  • No PDFs were ingested into storage/ for this pass beyond the source report itself; canonical external URLs serve as the primary r2_url for each new entry (consistent with prior passes).
  • One verification item carried forward: the Hevner 2014 vs. Mirzaa & Poduri 2014 PMC-ID collision. Recommend a future correction pass if full-text review shows these are the same paper.
Research Scaffold Bootstrap

The research area now uses three durable surfaces:

  • content/research/papers/ for per-paper Markdown records
  • content/research/indexes/research-index.yaml for structured paper metadata and Levi-specific takeaways
  • content/research/notes/ for freeform synthesis across diagnostics, treatments, mechanisms, and open questions

First substantive content should come from targeted questions posed to the Orchestrator and from curated source ingestion.